Latimeria chalumnae (coelacanth): 102358188 Help Entry 102358188         CDS       T02913                                  Symbol CXCL12 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism lcm  Latimeria chalumnae (coelacanth) Pathway lcm04060   Cytokine-cytokine receptor interaction lcm04672   Intestinal immune network for IgA production lcm04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:lcm00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102358188 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102358188 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     102358188 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lcm04052]     102358188 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:lcm00536]     102358188 (CXCL12) Cytokines and neuropeptides [BR:lcm04052]  Cytokines   Chemokines    102358188 (CXCL12) Glycosaminoglycan binding proteins [BR:lcm00536]  Heparan sulfate / Heparin   Chemokines    102358188 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  102358188 NCBI-ProteinID:  XP_006009497 Ensembl:  ENSLACG00000008568 UniProt:  H3AJ95 LinkDB All DBs Position Un AA seq 95 aa AA seqDB search MDVKAAAMITLVLVTLCVHTSYEKPIGLSQRCWCRYSEKVVHRGNIKQLKIRATPNCPLQ VIATLRNNGKQVCVDPEVKWLKQYLEKMINKRKKA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggatgtgaaagcagcagcgatgataaccttggtgctggtgacactgtgtgtccacacg tcatatgaaaagccgattggtctgagtcagaggtgctggtgccgatactctgagaaagtt gtccacaggggcaacattaaacaactgaagattcgggctacacccaactgtcctctgcaa gttattgccactttgaggaacaacggaaagcaagtgtgtgtagatcctgaggtgaaatgg ttgaagcagtacctggagaagatgataaacaaacggaaaaaggcgtaa

DBGET integrated database retrieval system