Leptosomus discolor (cuckoo roller): 104342836 Help Entry 104342836         CDS       T08399                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04010   MAPK signaling pathway ldi04020   Calcium signaling pathway ldi04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104342836 (FGF2)    04020 Calcium signaling pathway     104342836 (FGF2)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104342836 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ldi04052]     104342836 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:ldi00536]     104342836 (FGF2) Cytokines and neuropeptides [BR:ldi04052]  Cytokines   Growth factors (RTK binding)    104342836 (FGF2) Glycosaminoglycan binding proteins [BR:ldi00536]  Heparan sulfate / Heparin   Growth factors/receptors    104342836 (FGF2) SSDB OrthologParalogGFIT Motif Pfam:  FGF IL1 Motif Other DBs NCBI-GeneID:  104342836 NCBI-ProteinID:  XP_009944847 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MTGTSVAHQTSPAKLPYQRCRTDPVKLQLQAEERGVVSIKGVSANRFLAMNEDGRLLALK CATEECFFFERLESNNYNTYRSRKYSDWYVALKRTGQYKPGPKTGPGQKAILFLPMSAKS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgacgggtaccagtgttgcccatcagacttcccccgctaagctgccgtaccagcgttgc cgtacggacccagtcaaactgcagcttcaagcagaagaaagaggagtggtgtcaatcaaa ggtgtgagcgcaaatcgctttctggctatgaatgaggacggcagattgctggccttgaaa tgtgcaacagaagaatgtttcttttttgagcgtttggaatccaataactataacacttac cgatcacggaaatactccgactggtacgtggcactgaaaagaactgggcagtacaaacct ggaccaaagactggacctggacagaaagctatccttttcctccccatgtcagctaaaagc tga

DBGET integrated database retrieval system