Leptosomus discolor (cuckoo roller): 104353873 Help Entry 104353873         CDS       T08399                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi03260   Virion - Human immunodeficiency virus ldi03264   Virion - Flavivirus and Alphavirus ldi03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus ldi03273   Virion - Lassa virus and SFTS virus ldi04145   Phagosome ldi04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:ldi00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     104353873    03264 Virion - Flavivirus and Alphavirus     104353873    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     104353873    03273 Virion - Lassa virus and SFTS virus     104353873  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104353873  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104353873  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ldi04131]     104353873   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:ldi04054]     104353873    04515 Cell adhesion molecules [BR:ldi04515]     104353873    04090 CD molecules [BR:ldi04090]     104353873    04091 Lectins [BR:ldi04091]     104353873 Membrane trafficking [BR:ldi04131]  Endocytosis   Phagocytosis    C-lectin receptors     104353873 Pattern recognition receptors [BR:ldi04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    104353873 Cell adhesion molecules [BR:ldi04515]  Lectins   Selectins and C-type lectins    104353873 CD molecules [BR:ldi04090]  Proteins   104353873 Lectins [BR:ldi04091]  C-Type lectins   Asialoglycoprotein and DC receptors    104353873 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  104353873 NCBI-ProteinID:  XP_009958903 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MDEERLHDDLHVFRDRNFFQQRLRSFFTVYLLLALSFLLIITLFAVSLSRVSAISSKLNE VHVERKQNFSGRDFLLFPCGPGSREWEYFDGKCYYFSLTRTSWYKAKAQCEEMHSQLAVI NSYAKQNFVMFRTRNERFWIGLTDENSEGEWEWIDGTDYKTTFTFWKEGEPNNSGSNEDC AHVWISGKWNDVYCTYECYYVCEKPLPN NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggatgaggaacgtcttcacgacgacctgcacgttttcagagacagaaacttcttccag cagaggctgagatccttcttcacggtgtacttgctgctggccctctccttcttgctgatc atcaccctgtttgctgtgtccctctccagagtttcagccatttcttctaaactcaacgag gtgcacgtggaaaggaaacagaacttctccggcagggattttctcttgtttccctgcgga ccgggatccagggaatgggaatactttgatggaaaatgttactacttctccctaacgaga acgagctggtacaaggcgaaggctcagtgcgaagagatgcactcgcagttggccgtcatc aacagctacgccaagcagaattttgtcatgttcaggacaaggaatgagcgtttctggatc gggctcacggacgagaattcggaaggggaatgggaatggatcgacggcaccgactataaa accaccttcacattttggaaggagggagagcccaacaacagcggcagcaacgaagactgt gcccacgtctggatctctgggaagtggaacgacgtctactgcacctacgagtgctactac gtctgcgaaaagcctctgcccaactga

DBGET integrated database retrieval system