Leishmania sp. Ghana 2012 LV757: 94180333 Help Entry 94180333          CDS       T10390                                  Symbol GH5_04921 Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism leis  Leishmania sp. Ghana 2012 LV757 Pathway leis03420   Nucleotide excision repair leis04120   Ubiquitin mediated proteolysis leis04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:leis00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     94180333 (GH5_04921)    04120 Ubiquitin mediated proteolysis     94180333 (GH5_04921)   09124 Replication and repair    03420 Nucleotide excision repair     94180333 (GH5_04921)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:leis04121]     94180333 (GH5_04921)    03400 DNA repair and recombination proteins [BR:leis03400]     94180333 (GH5_04921) Enzymes [BR:leis01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      94180333 (GH5_04921) Ubiquitin system [BR:leis04121]  Ubiquitin ligases (E3)   UBL E3 ligases    94180333 (GH5_04921)   Multi subunit type E3    SCF complex     Ring finger protein      94180333 (GH5_04921)    Cul2 complex      94180333 (GH5_04921)    Cul3 complex      94180333 (GH5_04921)    Cul4 complex      94180333 (GH5_04921)    Cul7 complex      94180333 (GH5_04921)    Cul8 complex      94180333 (GH5_04921)    Cul9 complex      94180333 (GH5_04921) DNA repair and recombination proteins [BR:leis03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       94180333 (GH5_04921)     TCR (transcription coupled repair) factors      Cul4-CSA complex       94180333 (GH5_04921) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_16 PHD_NSD zf-RING_11 Motif Other DBs NCBI-GeneID:  94180333 NCBI-ProteinID:  XP_067701064 UniProt:  A0A836I313 LinkDB All DBs Position 24:642949..643308 Genome browser AA seq 119 aa AA seqDB search MSAEPSAASATASNAAPSSALMPGGQQLFTVEEFYPVYFSAWERETGLCSICCNQVEGPC VVCQSNAEATSAECSITWGECGHAFHTHCIEKWLKTRPVCPLDNKEWKDRSDWNTSAAV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcagccgagccttccgctgcctctgcaactgcttctaatgcagcgccgtcatcagca ttgatgccgggtggccagcagctcttcacagtggaagagttttacccagtttacttctcg gcctgggagcgcgagacgggcctgtgcagcatctgctgcaaccaagttgaagggccgtgc gtcgtatgccaaagcaacgcagaggccacttcagcggagtgcagcattacgtggggtgag tgcggccacgcttttcacacccactgcattgagaaatggttgaagacgcggccggtgtgc ccgctcgacaacaaagagtggaaggatcgctcagactggaacacctccgccgctgtgtag

DBGET integrated database retrieval system