Limosilactobacillus fermentum IFO 3956: LAF_0061 Help Entry LAF_0061          CDS       T00699                                  Name (GenBank) D-alanyl carrier protein   KO K14188   D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] Organism lfe  Limosilactobacillus fermentum IFO 3956 Pathway lfe00470   D-Amino acid metabolism lfe00552   Teichoic acid biosynthesis lfe01100   Metabolic pathways lfe01503   Cationic antimicrobial peptide (CAMP) resistance lfe02020   Two-component system Brite KEGG Orthology (KO) [BR:lfe00001]  09100 Metabolism   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     LAF_0061   09107 Glycan biosynthesis and metabolism    00552 Teichoic acid biosynthesis     LAF_0061  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     LAF_0061  09160 Human Diseases   09175 Drug resistance: antimicrobial    01503 Cationic antimicrobial peptide (CAMP) resistance     LAF_0061  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    01504 Antimicrobial resistance genes [BR:lfe01504]     LAF_0061 Enzymes [BR:lfe01000]  6. Ligases   6.1  Forming carbon-oxygen bonds    6.1.1  Ligases forming aminoacyl-tRNA and related compounds     6.1.1.13  D-alanine---poly(phosphoribitol) ligase      LAF_0061 Antimicrobial resistance genes [BR:lfe01504]  Gene sets   CAMP resistance modules    Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]     LAF_0061 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  BAG26397 UniProt:  A0ABF7R0G8 LinkDB All DBs Position complement(77683..77934) Genome browser AA seq 83 aa AA seqDB search MEVFTMIEKIQELLAQATGRDAADFADADENLFDSGLIDSMATVQFLFSLQDEYDITVPV SEFDRDEWNTVNKIADRVKELQA NT seq 252 nt NT seq  +upstreamnt  +downstreamnt ttggaggtatttaccatgattgaaaagattcaagaactcttagcccaagcaactggccgt gacgccgctgacttcgccgatgccgacgaaaacctctttgactccggtttgatcgactcc atggccaccgttcaattcctcttctccttgcaagacgaatacgacatcaccgttccggtg tccgaatttgaccgtgacgaatggaacacggtcaacaagatcgccgaccgggtcaaggaa ttacaagcataa

DBGET integrated database retrieval system