Leopardus geoffroyi (Geoffroy's cat): 123602296 Help Entry 123602296         CDS       T10761                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf01523   Antifolate resistance lgf04010   MAPK signaling pathway lgf04014   Ras signaling pathway lgf04024   cAMP signaling pathway lgf04062   Chemokine signaling pathway lgf04064   NF-kappa B signaling pathway lgf04066   HIF-1 signaling pathway lgf04071   Sphingolipid signaling pathway lgf04137   Mitophagy - animal lgf04151   PI3K-Akt signaling pathway lgf04210   Apoptosis lgf04211   Longevity regulating pathway lgf04218   Cellular senescence lgf04380   Osteoclast differentiation lgf04613   Neutrophil extracellular trap formation lgf04620   Toll-like receptor signaling pathway lgf04621   NOD-like receptor signaling pathway lgf04622   RIG-I-like receptor signaling pathway lgf04623   Cytosolic DNA-sensing pathway lgf04625   C-type lectin receptor signaling pathway lgf04657   IL-17 signaling pathway lgf04658   Th1 and Th2 cell differentiation lgf04659   Th17 cell differentiation lgf04660   T cell receptor signaling pathway lgf04662   B cell receptor signaling pathway lgf04668   TNF signaling pathway lgf04722   Neurotrophin signaling pathway lgf04917   Prolactin signaling pathway lgf04920   Adipocytokine signaling pathway lgf04926   Relaxin signaling pathway lgf04931   Insulin resistance lgf04932   Non-alcoholic fatty liver disease lgf04933   AGE-RAGE signaling pathway in diabetic complications lgf04936   Alcoholic liver disease lgf05010   Alzheimer disease lgf05022   Pathways of neurodegeneration - multiple diseases lgf05030   Cocaine addiction lgf05132   Salmonella infection lgf05133   Pertussis lgf05134   Legionellosis lgf05135   Yersinia infection lgf05140   Leishmaniasis lgf05142   Chagas disease lgf05145   Toxoplasmosis lgf05146   Amoebiasis lgf05152   Tuberculosis lgf05160   Hepatitis C lgf05161   Hepatitis B lgf05162   Measles lgf05163   Human cytomegalovirus infection lgf05164   Influenza A lgf05165   Human papillomavirus infection lgf05166   Human T-cell leukemia virus 1 infection lgf05167   Kaposi sarcoma-associated herpesvirus infection lgf05168   Herpes simplex virus 1 infection lgf05169   Epstein-Barr virus infection lgf05170   Human immunodeficiency virus 1 infection lgf05171   Coronavirus disease - COVID-19 lgf05200   Pathways in cancer lgf05202   Transcriptional misregulation in cancer lgf05203   Viral carcinogenesis lgf05207   Chemical carcinogenesis - receptor activation lgf05208   Chemical carcinogenesis - reactive oxygen species lgf05212   Pancreatic cancer lgf05215   Prostate cancer lgf05220   Chronic myeloid leukemia lgf05221   Acute myeloid leukemia lgf05222   Small cell lung cancer lgf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer lgf05321   Inflammatory bowel disease lgf05415   Diabetic cardiomyopathy lgf05417   Lipid and atherosclerosis lgf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lgf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     123602296 (RELA)    04014 Ras signaling pathway     123602296 (RELA)    04064 NF-kappa B signaling pathway     123602296 (RELA)    04668 TNF signaling pathway     123602296 (RELA)    04066 HIF-1 signaling pathway     123602296 (RELA)    04071 Sphingolipid signaling pathway     123602296 (RELA)    04024 cAMP signaling pathway     123602296 (RELA)    04151 PI3K-Akt signaling pathway     123602296 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     123602296 (RELA)   09143 Cell growth and death    04210 Apoptosis     123602296 (RELA)    04218 Cellular senescence     123602296 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     123602296 (RELA)    04620 Toll-like receptor signaling pathway     123602296 (RELA)    04621 NOD-like receptor signaling pathway     123602296 (RELA)    04622 RIG-I-like receptor signaling pathway     123602296 (RELA)    04623 Cytosolic DNA-sensing pathway     123602296 (RELA)    04625 C-type lectin receptor signaling pathway     123602296 (RELA)    04660 T cell receptor signaling pathway     123602296 (RELA)    04658 Th1 and Th2 cell differentiation     123602296 (RELA)    04659 Th17 cell differentiation     123602296 (RELA)    04657 IL-17 signaling pathway     123602296 (RELA)    04662 B cell receptor signaling pathway     123602296 (RELA)    04062 Chemokine signaling pathway     123602296 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     123602296 (RELA)    04917 Prolactin signaling pathway     123602296 (RELA)    04926 Relaxin signaling pathway     123602296 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     123602296 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     123602296 (RELA)   09149 Aging    04211 Longevity regulating pathway     123602296 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     123602296 (RELA)    05202 Transcriptional misregulation in cancer     123602296 (RELA)    05207 Chemical carcinogenesis - receptor activation     123602296 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     123602296 (RELA)    05203 Viral carcinogenesis     123602296 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     123602296 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     123602296 (RELA)    05221 Acute myeloid leukemia     123602296 (RELA)    05220 Chronic myeloid leukemia     123602296 (RELA)    05215 Prostate cancer     123602296 (RELA)    05222 Small cell lung cancer     123602296 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     123602296 (RELA)    05170 Human immunodeficiency virus 1 infection     123602296 (RELA)    05161 Hepatitis B     123602296 (RELA)    05160 Hepatitis C     123602296 (RELA)    05171 Coronavirus disease - COVID-19     123602296 (RELA)    05164 Influenza A     123602296 (RELA)    05162 Measles     123602296 (RELA)    05168 Herpes simplex virus 1 infection     123602296 (RELA)    05163 Human cytomegalovirus infection     123602296 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     123602296 (RELA)    05169 Epstein-Barr virus infection     123602296 (RELA)    05165 Human papillomavirus infection     123602296 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     123602296 (RELA)    05135 Yersinia infection     123602296 (RELA)    05133 Pertussis     123602296 (RELA)    05134 Legionellosis     123602296 (RELA)    05152 Tuberculosis     123602296 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     123602296 (RELA)    05145 Toxoplasmosis     123602296 (RELA)    05140 Leishmaniasis     123602296 (RELA)    05142 Chagas disease     123602296 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     123602296 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     123602296 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     123602296 (RELA)   09165 Substance dependence    05030 Cocaine addiction     123602296 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     123602296 (RELA)    05418 Fluid shear stress and atherosclerosis     123602296 (RELA)    05415 Diabetic cardiomyopathy     123602296 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     123602296 (RELA)    04932 Non-alcoholic fatty liver disease     123602296 (RELA)    04931 Insulin resistance     123602296 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     123602296 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     123602296 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:lgf03000]     123602296 (RELA) Transcription factors [BR:lgf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     123602296 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  123602296 NCBI-ProteinID:  XP_045342734 LinkDB All DBs Position D1:complement(108904786..108913837) Genome browser AA seq 555 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL AQAVVPPAPKTTQAGEGTLTEALLQLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ LLNQGVSVAPHPAEPMLMEYPESITRLMTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS IADMDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacactgggccagggacagttcgcatctcattggtcaccaaggac ccccctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagaacagcgtggggactacgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg catcccatctttgacaaccgtgcccccaacaccgccgagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatatgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttcccttctgggcagatcccaagccagacccctgccttg gcaccagcccctgccccaatcctggccccagcgcctgcctctgtcccggcccctgcccct gtccccgcccctgccccggccccagccccggcccctgccccaatcttagccccaggcctt gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg gaggccctgctgcagctgcagtttgacgctgatgaagacctgggggccctgcttggcaac agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac cctgagtcaataactcgcctgatgacgggatcccagaggccccctgacccggctcccgct cccctgggggcctctgggcttcccaatggcctcctctcaggggatgaagacttctcttct attgccgacatggacttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system