Leopardus geoffroyi (Geoffroy's cat): 123607326 Help Entry 123607326         CDS       T10761                                  Symbol CD209 Name (RefSeq) CD209 antigen   KO K06563   C-type lectin domain family 4 member L/M Organism lgf  Leopardus geoffroyi (Geoffroy's cat) Pathway lgf03260   Virion - Human immunodeficiency virus lgf03264   Virion - Flavivirus and Alphavirus lgf03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus lgf03273   Virion - Lassa virus and SFTS virus lgf04145   Phagosome lgf04625   C-type lectin receptor signaling pathway lgf05152   Tuberculosis lgf05162   Measles Brite KEGG Orthology (KO) [BR:lgf00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     123607326 (CD209)    03264 Virion - Flavivirus and Alphavirus     123607326 (CD209)    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     123607326 (CD209)    03273 Virion - Lassa virus and SFTS virus     123607326 (CD209)  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     123607326 (CD209)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     123607326 (CD209)  09160 Human Diseases   09172 Infectious disease: viral    05162 Measles     123607326 (CD209)   09171 Infectious disease: bacterial    05152 Tuberculosis     123607326 (CD209)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lgf04131]     123607326 (CD209)   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:lgf04054]     123607326 (CD209)    04515 Cell adhesion molecules [BR:lgf04515]     123607326 (CD209)    04090 CD molecules [BR:lgf04090]     123607326 (CD209)    04091 Lectins [BR:lgf04091]     123607326 (CD209) Membrane trafficking [BR:lgf04131]  Endocytosis   Phagocytosis    C-lectin receptors     123607326 (CD209) Pattern recognition receptors [BR:lgf04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    123607326 (CD209) Cell adhesion molecules [BR:lgf04515]  Lectins   Selectins and C-type lectins    123607326 (CD209) CD molecules [BR:lgf04090]  Proteins   123607326 (CD209) Lectins [BR:lgf04091]  C-Type lectins   Asialoglycoprotein and DC receptors    123607326 (CD209) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C Peptidase_S15 UL45 Motif Other DBs NCBI-GeneID:  123607326 NCBI-ProteinID:  XP_045352411 LinkDB All DBs Position A2:6061077..6064617 Genome browser AA seq 254 aa AA seqDB search MAEMCDPKEPDDPEVEVFGDQRLAKKYTGLLRSSRSLPGCLTQAHLPLLLLLVSLGFFML LVTTLVQVSRIHQSLQRDTGDHRERNHQESPGLGDVSQAQKQSSLEEILQQLTWMNATLA GLCRHCPWKWELFQGSCYFFSLTQNTWKESIAACQNMRAQLVVINSTEEQKFLKSWNTKN SQRTWIGLSDHHNEGSWRWVDDTPLQLSFWKEGEPNNHGDEDCVELYSDGWNDNRCSTEN FWICKKPSSPCPGP NT seq 765 nt NT seq  +upstreamnt  +downstreamnt atggcggagatgtgtgaccccaaggagccggatgaccccgaggtggaggtgtttggggac cagagactggctaagaaatacaccggcctgctcaggagctcacggagcctgccagggtgt ctgacccaggcccacctgcctctgctgctgcttctcgtctctctgggcttcttcatgctc ctggtgaccactctggttcaagtctccaggatccaccaatccctgcagagagacacaggg gaccatcgggagaggaaccatcaggagagccccggcctcggggatgtttctcaggcccag aaacaatcatccctggaggagatactccagcagctgacctggatgaatgccaccctggct ggcctgtgccgccactgcccctggaaatgggaacttttccagggaagctgctatttcttc tccctgacccagaacacctggaaagagtccattgccgcgtgtcagaacatgagggcccag ctggtggtcatcaacagcactgaggagcagaaatttctgaagtcttggaatacgaaaaat agccagcgcacatggattggcctcagtgaccaccacaatgagggttcttggagatgggtg gacgacactcccctccaactcagcttctggaaagaaggggaacccaacaaccacggggat gaggactgtgtggaattgtacagtgacggctggaatgacaacagatgtagtacagaaaac ttctggatctgtaagaagccctcgtccccctgcccgggcccctga

DBGET integrated database retrieval system