Lotus japonicus: 130747013 Help Entry 130747013         CDS       T04348                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lja  Lotus japonicus Pathway lja03420   Nucleotide excision repair lja04120   Ubiquitin mediated proteolysis lja04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130747013    04120 Ubiquitin mediated proteolysis     130747013   09124 Replication and repair    03420 Nucleotide excision repair     130747013  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lja04121]     130747013    03400 DNA repair and recombination proteins [BR:lja03400]     130747013 Enzymes [BR:lja01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130747013 Ubiquitin system [BR:lja04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130747013   Multi subunit type E3    SCF complex     Ring finger protein      130747013    Cul2 complex      130747013    Cul3 complex      130747013    Cul4 complex      130747013    Cul7 complex      130747013    Cul8 complex      130747013    Cul9 complex      130747013 DNA repair and recombination proteins [BR:lja03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130747013     TCR (transcription coupled repair) factors      Cul4-CSA complex       130747013 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  130747013 NCBI-ProteinID:  XP_057455805 LinkDB All DBs Position 3:complement(88005477..88008716) Genome browser AA seq 117 aa AA seqDB search MAETLDSDVAMVPAGEPSSSAGPSSKKSKRFEIKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASPTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggcggagactcttgattccgatgtggcgatggttcccgccggcgaaccttcaagcagc gccggcccttcttccaagaagtccaaacgcttcgagatcaagaagtggaacgccgtcgct ctctgggcttgggacattgtcgttgataactgtgctatctgccgcaaccacatcatggat ctctgtatagagtgccaagctaaccaggctagcccaactagcgaagaatgcactgtggct tggggggtttgtaaccatgcttttcacttccattgcattagtcgatggctcaagacccgc caagtatgtcctctagataacagtgagtgggagtttcagaaatatggccactag

DBGET integrated database retrieval system