Lotus japonicus: 130749219 Help Entry 130749219         CDS       T04348                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lja  Lotus japonicus Pathway lja03420   Nucleotide excision repair lja04120   Ubiquitin mediated proteolysis lja04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lja00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130749219    04120 Ubiquitin mediated proteolysis     130749219   09124 Replication and repair    03420 Nucleotide excision repair     130749219  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lja04121]     130749219    03400 DNA repair and recombination proteins [BR:lja03400]     130749219 Enzymes [BR:lja01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      130749219 Ubiquitin system [BR:lja04121]  Ubiquitin ligases (E3)   UBL E3 ligases    130749219   Multi subunit type E3    SCF complex     Ring finger protein      130749219    Cul2 complex      130749219    Cul3 complex      130749219    Cul4 complex      130749219    Cul7 complex      130749219    Cul8 complex      130749219    Cul9 complex      130749219 DNA repair and recombination proteins [BR:lja03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       130749219     TCR (transcription coupled repair) factors      Cul4-CSA complex       130749219 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  130749219 NCBI-ProteinID:  XP_057458524 LinkDB All DBs Position 3:27530910..27534223 Genome browser AA seq 119 aa AA seqDB search MATLDSDVQMVPADDPSAAGAGPSSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICRNHI MDRCIECQANQASSTADECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggcgactctggattccgacgtgcaaatggttcccgccgacgatccctccgccgccggc gccggtccttcttcttcttccaagaaacccaagcgcttcgagatcaagaagtggaacgcc gttgctctctgggcttgggacatcgttgtcgataactgtgctatctgccgaaaccacatc atggatcgctgtattgagtgtcaggccaatcaggctagctccactgctgatgagtgcact gttgcttggggtgtttgtaaccatgcttttcattttcattgcattagccgatggctcaag acccgtcaagtatgtcctctagataacagtgagtgggagtttcagaaatacggtcactag

DBGET integrated database retrieval system