Lactococcus lactis subsp. lactis Il1403: L162872 Help Entry L162872           CDS       T00045                                  Symbol dfrA Name (GenBank) dihydropholate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism lla  Lactococcus lactis subsp. lactis Il1403 Pathway lla00670   One carbon pool by folate lla00790   Folate biosynthesis lla01100   Metabolic pathways lla01240   Biosynthesis of cofactors lla04981   Folate transport and metabolism Module lla_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:lla00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     L162872 (dfrA)    00670 One carbon pool by folate     L162872 (dfrA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     L162872 (dfrA) Enzymes [BR:lla01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      L162872 (dfrA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AAK05248 UniProt:  Q59487 LinkDB All DBs Position 1163134..1163640 Genome browser AA seq 168 aa AA seqDB search MIIGIWAEDEAGLIGEADKMPWSLPAEQQHFKETTMNQVILMGRKTFEGMNKRVLPGRIS IILTRDETYQSDNEKVLIMHSPKEVLDWYHKQNKDLFITGGAEILALFESELELLYRTVV HEKFKGDTYFPSTFDFGRFKLVSEKFHDKDERNSYTFTIKKYEKVKQP NT seq 507 nt NT seq  +upstreamnt  +downstreamnt atgataattggaatatgggcagaagatgaagcaggtcttatcggtgaagctgataaaatg ccttggtctttacctgctgaacaacaacattttaaagaaacaaccatgaatcaagtgatt ttgatgggacgaaaaacgtttgaaggcatgaataaacgtgtattgccagggagaataagt attattttaactcgcgatgaaacttatcaatcagataatgaaaaagtgctcatcatgcac agccctaaggaagttctagattggtaccataagcaaaataaagacttatttatcacagga ggagctgaaattttagccctttttgaatctgaacttgaattgctctatcgaacagttgtt catgaaaaatttaaaggagatacttattttccaagtacatttgactttggaagatttaag ctagtctctgaaaaatttcacgataaagatgagcggaattcttatacttttacaattaaa aaatatgaaaaagtgaaacaaccatga

DBGET integrated database retrieval system