Lutra lutra (Eurasian river otter): 125081177 Help Entry 125081177         CDS       T08100                                  Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv01521   EGFR tyrosine kinase inhibitor resistance llv01523   Antifolate resistance llv04060   Cytokine-cytokine receptor interaction llv04061   Viral protein interaction with cytokine and cytokine receptor llv04066   HIF-1 signaling pathway llv04068   FoxO signaling pathway llv04151   PI3K-Akt signaling pathway llv04218   Cellular senescence llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04623   Cytosolic DNA-sensing pathway llv04625   C-type lectin receptor signaling pathway llv04630   JAK-STAT signaling pathway llv04640   Hematopoietic cell lineage llv04657   IL-17 signaling pathway llv04659   Th17 cell differentiation llv04668   TNF signaling pathway llv04672   Intestinal immune network for IgA production llv04931   Insulin resistance llv04932   Non-alcoholic fatty liver disease llv04933   AGE-RAGE signaling pathway in diabetic complications llv04936   Alcoholic liver disease llv05010   Alzheimer disease llv05020   Prion disease llv05022   Pathways of neurodegeneration - multiple diseases llv05132   Salmonella infection llv05133   Pertussis llv05134   Legionellosis llv05135   Yersinia infection llv05142   Chagas disease llv05143   African trypanosomiasis llv05144   Malaria llv05146   Amoebiasis llv05152   Tuberculosis llv05161   Hepatitis B llv05162   Measles llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05166   Human T-cell leukemia virus 1 infection llv05167   Kaposi sarcoma-associated herpesvirus infection llv05168   Herpes simplex virus 1 infection llv05169   Epstein-Barr virus infection llv05171   Coronavirus disease - COVID-19 llv05200   Pathways in cancer llv05202   Transcriptional misregulation in cancer llv05321   Inflammatory bowel disease llv05323   Rheumatoid arthritis llv05332   Graft-versus-host disease llv05410   Hypertrophic cardiomyopathy llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125081177    04668 TNF signaling pathway     125081177    04066 HIF-1 signaling pathway     125081177    04068 FoxO signaling pathway     125081177    04151 PI3K-Akt signaling pathway     125081177   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125081177    04061 Viral protein interaction with cytokine and cytokine receptor     125081177  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     125081177  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125081177    04620 Toll-like receptor signaling pathway     125081177    04621 NOD-like receptor signaling pathway     125081177    04623 Cytosolic DNA-sensing pathway     125081177    04625 C-type lectin receptor signaling pathway     125081177    04659 Th17 cell differentiation     125081177    04657 IL-17 signaling pathway     125081177    04672 Intestinal immune network for IgA production     125081177  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125081177    05202 Transcriptional misregulation in cancer     125081177   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125081177    05161 Hepatitis B     125081177    05171 Coronavirus disease - COVID-19     125081177    05164 Influenza A     125081177    05162 Measles     125081177    05168 Herpes simplex virus 1 infection     125081177    05163 Human cytomegalovirus infection     125081177    05167 Kaposi sarcoma-associated herpesvirus infection     125081177    05169 Epstein-Barr virus infection     125081177   09171 Infectious disease: bacterial    05132 Salmonella infection     125081177    05135 Yersinia infection     125081177    05133 Pertussis     125081177    05134 Legionellosis     125081177    05152 Tuberculosis     125081177   09174 Infectious disease: parasitic    05146 Amoebiasis     125081177    05144 Malaria     125081177    05142 Chagas disease     125081177    05143 African trypanosomiasis     125081177   09163 Immune disease    05323 Rheumatoid arthritis     125081177    05321 Inflammatory bowel disease     125081177    05332 Graft-versus-host disease     125081177   09164 Neurodegenerative disease    05010 Alzheimer disease     125081177    05020 Prion disease     125081177    05022 Pathways of neurodegeneration - multiple diseases     125081177   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125081177    05410 Hypertrophic cardiomyopathy     125081177   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125081177    04932 Non-alcoholic fatty liver disease     125081177    04931 Insulin resistance     125081177    04933 AGE-RAGE signaling pathway in diabetic complications     125081177   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     125081177    01523 Antifolate resistance     125081177  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125081177 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Interleukins    125081177 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL6 IL11 GCSF Motif Other DBs NCBI-GeneID:  125081177 NCBI-ProteinID:  XP_047551675 LinkDB All DBs Position 11:55420581..55425916 Genome browser AA seq 210 aa AA seqDB search MNSLSTSAFSPVAFSLGLLLVMATAFPTPGPLGGDSKDDATSNRPPLTSADKMEDFIKFI LGKISALRNEMCDKYNKCEDSKEALAENNLNLPKLAEKDRCFQSRFNQETCLTRITTGLQ EFQIHLKYLESNYEGNKDNAHSVYISTKHLLQTLRPMNQIEVTTPDPTTDASLQALFKSQ DKWLKHTTIHLILRRLEDFLQFSLRAIRIM NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgaactccctctccacaagcgccttcagtccagtggccttctctctgggactgctcctg gtgatggctactgctttccctaccccgggacccctgggaggagattccaaagatgatgcc acctcaaacagaccaccactcacctctgcagacaaaatggaagacttcattaagttcatc cttggcaaaatctctgcactgagaaatgagatgtgtgacaagtataacaagtgtgaagac agcaaggaggcactggcagagaacaacctaaatcttccaaaactggccgaaaaggacaga tgcttccagtctcgattcaatcaggagacctgtctgacaagaatcactaccggtcttcag gagtttcagatacacctgaaatacctagagtccaactatgagggtaataaggacaatgcc cactctgtgtacatcagcaccaaacacctgctccagacgctgaggcccatgaatcagatt gaagtgaccacccccgaccctaccacagatgccagcctgcaggctctcttcaagtcgcag gacaagtggctgaaacacacaacaattcacctcatcctaaggagacttgaggatttcctg cagttcagcctgagggccattcggatcatgtag

DBGET integrated database retrieval system