Lutra lutra (Eurasian river otter): 125083789 Help Entry 125083789         CDS       T08100                                  Name (RefSeq) interferon beta-like   KO K05415   interferon beta Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04060   Cytokine-cytokine receptor interaction llv04151   PI3K-Akt signaling pathway llv04217   Necroptosis llv04380   Osteoclast differentiation llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04622   RIG-I-like receptor signaling pathway llv04623   Cytosolic DNA-sensing pathway llv04630   JAK-STAT signaling pathway llv04650   Natural killer cell mediated cytotoxicity llv04668   TNF signaling pathway llv04936   Alcoholic liver disease llv05135   Yersinia infection llv05142   Chagas disease llv05152   Tuberculosis llv05160   Hepatitis C llv05161   Hepatitis B llv05162   Measles llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05165   Human papillomavirus infection llv05167   Kaposi sarcoma-associated herpesvirus infection llv05168   Herpes simplex virus 1 infection llv05169   Epstein-Barr virus infection llv05170   Human immunodeficiency virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     125083789    04668 TNF signaling pathway     125083789    04151 PI3K-Akt signaling pathway     125083789   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125083789  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125083789  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125083789    04621 NOD-like receptor signaling pathway     125083789    04622 RIG-I-like receptor signaling pathway     125083789    04623 Cytosolic DNA-sensing pathway     125083789    04650 Natural killer cell mediated cytotoxicity     125083789   09158 Development and regeneration    04380 Osteoclast differentiation     125083789  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125083789    05161 Hepatitis B     125083789    05160 Hepatitis C     125083789    05171 Coronavirus disease - COVID-19     125083789    05164 Influenza A     125083789    05162 Measles     125083789    05168 Herpes simplex virus 1 infection     125083789    05163 Human cytomegalovirus infection     125083789    05167 Kaposi sarcoma-associated herpesvirus infection     125083789    05169 Epstein-Barr virus infection     125083789    05165 Human papillomavirus infection     125083789   09171 Infectious disease: bacterial    05135 Yersinia infection     125083789    05152 Tuberculosis     125083789   09174 Infectious disease: parasitic    05142 Chagas disease     125083789   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125083789   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     125083789  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125083789 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Interferons    125083789 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  125083789 NCBI-ProteinID:  XP_047556651 LinkDB All DBs Position 13:complement(47126185..47126745) Genome browser AA seq 186 aa AA seqDB search MTSRCILQTALLVYFSTTVLAMNYNLLRFQLSSSSVECQELLLQLNGTSKDCLKDRMNFK IPEEIQKSQQFQKEDIVLVTLEMFQKTSDIFRRNLSSTGWNESIVENLLATLHWQKEHLE EILEDIMQEENFTWDHRTLLHLKRYYLRIVRYLKAKEYSVCAWTIVQAEILKSFFFLDKL TDSLPN NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccagcaggtgtatcctccaaactgctctcctggtatatttttccaccacggttctt gccatgaactataacttgcttcgattccaactaagcagcagcagtgtggagtgccaggag ctccttctgcagttgaatggaacttctaaagattgcctcaaggacaggatgaacttcaag atacctgaggagatccagaaatcccagcagttccagaaggaggacatcgtattggtcacc cttgagatgttccagaagacctctgatattttcaggagaaatctctcaagcacgggatgg aatgagagcattgtcgagaacctccttgccacactccactggcagaaggaacatctggag gaaatcctggaggacatcatgcaggaggaaaacttcacttgggaccacaggacccttctg cacctgaagagatattatctaaggatcgtgcggtacctgaaagccaaggagtacagcgtc tgtgcctggacaatagtgcaagcagaaatcctcaaaagctttttcttccttgataaactt acagattctctccctaactga

DBGET integrated database retrieval system