Lutra lutra (Eurasian river otter): 125103142 Help Entry 125103142         CDS       T08100                                  Name (RefSeq) tumor necrosis factor isoform X1   KO K03156   tumor necrosis factor superfamily, member 2 Organism llv  Lutra lutra (Eurasian river otter) Pathway llv01523   Antifolate resistance llv04010   MAPK signaling pathway llv04060   Cytokine-cytokine receptor interaction llv04061   Viral protein interaction with cytokine and cytokine receptor llv04064   NF-kappa B signaling pathway llv04071   Sphingolipid signaling pathway llv04150   mTOR signaling pathway llv04210   Apoptosis llv04217   Necroptosis llv04350   TGF-beta signaling pathway llv04380   Osteoclast differentiation llv04612   Antigen processing and presentation llv04620   Toll-like receptor signaling pathway llv04621   NOD-like receptor signaling pathway llv04622   RIG-I-like receptor signaling pathway llv04625   C-type lectin receptor signaling pathway llv04640   Hematopoietic cell lineage llv04650   Natural killer cell mediated cytotoxicity llv04657   IL-17 signaling pathway llv04660   T cell receptor signaling pathway llv04664   Fc epsilon RI signaling pathway llv04668   TNF signaling pathway llv04920   Adipocytokine signaling pathway llv04930   Type II diabetes mellitus llv04931   Insulin resistance llv04932   Non-alcoholic fatty liver disease llv04933   AGE-RAGE signaling pathway in diabetic complications llv04936   Alcoholic liver disease llv04940   Type I diabetes mellitus llv05010   Alzheimer disease llv05014   Amyotrophic lateral sclerosis llv05020   Prion disease llv05022   Pathways of neurodegeneration - multiple diseases llv05132   Salmonella infection llv05133   Pertussis llv05134   Legionellosis llv05135   Yersinia infection llv05140   Leishmaniasis llv05142   Chagas disease llv05143   African trypanosomiasis llv05144   Malaria llv05145   Toxoplasmosis llv05146   Amoebiasis llv05152   Tuberculosis llv05160   Hepatitis C llv05161   Hepatitis B llv05163   Human cytomegalovirus infection llv05164   Influenza A llv05165   Human papillomavirus infection llv05166   Human T-cell leukemia virus 1 infection llv05168   Herpes simplex virus 1 infection llv05169   Epstein-Barr virus infection llv05170   Human immunodeficiency virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05205   Proteoglycans in cancer llv05310   Asthma llv05321   Inflammatory bowel disease llv05322   Systemic lupus erythematosus llv05323   Rheumatoid arthritis llv05330   Allograft rejection llv05332   Graft-versus-host disease llv05410   Hypertrophic cardiomyopathy llv05414   Dilated cardiomyopathy llv05417   Lipid and atherosclerosis llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125103142    04350 TGF-beta signaling pathway     125103142    04064 NF-kappa B signaling pathway     125103142    04668 TNF signaling pathway     125103142    04071 Sphingolipid signaling pathway     125103142    04150 mTOR signaling pathway     125103142   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125103142    04061 Viral protein interaction with cytokine and cytokine receptor     125103142  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     125103142    04217 Necroptosis     125103142  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     125103142    04620 Toll-like receptor signaling pathway     125103142    04621 NOD-like receptor signaling pathway     125103142    04622 RIG-I-like receptor signaling pathway     125103142    04625 C-type lectin receptor signaling pathway     125103142    04650 Natural killer cell mediated cytotoxicity     125103142    04612 Antigen processing and presentation     125103142    04660 T cell receptor signaling pathway     125103142    04657 IL-17 signaling pathway     125103142    04664 Fc epsilon RI signaling pathway     125103142   09152 Endocrine system    04920 Adipocytokine signaling pathway     125103142   09158 Development and regeneration    04380 Osteoclast differentiation     125103142  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     125103142   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125103142    05170 Human immunodeficiency virus 1 infection     125103142    05161 Hepatitis B     125103142    05160 Hepatitis C     125103142    05171 Coronavirus disease - COVID-19     125103142    05164 Influenza A     125103142    05168 Herpes simplex virus 1 infection     125103142    05163 Human cytomegalovirus infection     125103142    05169 Epstein-Barr virus infection     125103142    05165 Human papillomavirus infection     125103142   09171 Infectious disease: bacterial    05132 Salmonella infection     125103142    05135 Yersinia infection     125103142    05133 Pertussis     125103142    05134 Legionellosis     125103142    05152 Tuberculosis     125103142   09174 Infectious disease: parasitic    05146 Amoebiasis     125103142    05144 Malaria     125103142    05145 Toxoplasmosis     125103142    05140 Leishmaniasis     125103142    05142 Chagas disease     125103142    05143 African trypanosomiasis     125103142   09163 Immune disease    05310 Asthma     125103142    05322 Systemic lupus erythematosus     125103142    05323 Rheumatoid arthritis     125103142    05321 Inflammatory bowel disease     125103142    05330 Allograft rejection     125103142    05332 Graft-versus-host disease     125103142   09164 Neurodegenerative disease    05010 Alzheimer disease     125103142    05014 Amyotrophic lateral sclerosis     125103142    05020 Prion disease     125103142    05022 Pathways of neurodegeneration - multiple diseases     125103142   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125103142    05418 Fluid shear stress and atherosclerosis     125103142    05410 Hypertrophic cardiomyopathy     125103142    05414 Dilated cardiomyopathy     125103142   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     125103142    04940 Type I diabetes mellitus     125103142    04936 Alcoholic liver disease     125103142    04932 Non-alcoholic fatty liver disease     125103142    04931 Insulin resistance     125103142    04933 AGE-RAGE signaling pathway in diabetic complications     125103142   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     125103142  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125103142    00536 Glycosaminoglycan binding proteins [BR:llv00536]     125103142 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Tumor necrosis fators    125103142 Glycosaminoglycan binding proteins [BR:llv00536]  Heparan sulfate / Heparin   Cytokines    125103142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  125103142 NCBI-ProteinID:  XP_047590937 LinkDB All DBs Position 6:29746640..29749303 Genome browser AA seq 234 aa AA seqDB search MSTESMIRDVELGEEALPKKAGSPKGSRRCWCLSLFSFLLVAGATTLFCLLHFGVIGPQR EEQLPDGLQLIKPLAQTVKSSSRTPSDKPVAHVVANPEAEGQLQWLSRRANALLANGVEL TDNQLIVPSDGLYLIYSQVLFKGQGCSSTNVLLTHTISRFAVSYQTKVNLLSAIKSPCQR ETPEGTEAKPWYEPIYLGGVFQLEKGDRLSAEINLPDYLDFAESGQVYFGIIAL NT seq 705 nt NT seq  +upstreamnt  +downstreamnt atgagcactgaaagcatgatccgggacgtggagctgggcgaggaggcactccccaagaag gcagggtcccccaagggctcccgaaggtgctggtgcctcagcctcttctccttcctcctc gtcgcaggagccaccacactcttctgcctgctgcactttggagtgatcggcccccagagg gaagagcagctcccagatggcctccaactaatcaaacctctggcccagacagtcaaatca tcttctcgaactccaagtgacaagcccgtagctcatgttgtagcaaaccctgaagctgag gggcaactccaatggctgagccggcgtgccaatgccctcctggccaatggtgtggagctg acagacaaccagctaatagtgccatcagacgggctgtacctcatctactcccaggtcctc ttcaagggccaaggatgttcttccaccaatgtgctcctcacccacaccatcagccgcttt gctgtctcctaccagaccaaggtcaacctcctctctgccatcaagagcccttgccaaagg gagaccccagagggaactgaggccaagccctggtacgagcccatctacctgggaggggtc ttccaattggagaagggggatcgactcagcgctgagatcaacctgcctgactatctcgac tttgccgaatccgggcaggtctactttggaatcattgccctgtga

DBGET integrated database retrieval system