Lutra lutra (Eurasian river otter): 125105343 Help Entry 125105343         CDS       T08100                                  Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism llv  Lutra lutra (Eurasian river otter) Pathway llv01522   Endocrine resistance llv04010   MAPK signaling pathway llv04024   cAMP signaling pathway llv04210   Apoptosis llv04380   Osteoclast differentiation llv04620   Toll-like receptor signaling pathway llv04657   IL-17 signaling pathway llv04658   Th1 and Th2 cell differentiation llv04659   Th17 cell differentiation llv04660   T cell receptor signaling pathway llv04662   B cell receptor signaling pathway llv04668   TNF signaling pathway llv04713   Circadian entrainment llv04725   Cholinergic synapse llv04728   Dopaminergic synapse llv04915   Estrogen signaling pathway llv04917   Prolactin signaling pathway llv04921   Oxytocin signaling pathway llv04926   Relaxin signaling pathway llv04928   Parathyroid hormone synthesis, secretion and action llv04932   Non-alcoholic fatty liver disease llv04935   Growth hormone synthesis, secretion and action llv05031   Amphetamine addiction llv05132   Salmonella infection llv05133   Pertussis llv05135   Yersinia infection llv05140   Leishmaniasis llv05142   Chagas disease llv05161   Hepatitis B llv05162   Measles llv05166   Human T-cell leukemia virus 1 infection llv05167   Kaposi sarcoma-associated herpesvirus infection llv05170   Human immunodeficiency virus 1 infection llv05171   Coronavirus disease - COVID-19 llv05200   Pathways in cancer llv05207   Chemical carcinogenesis - receptor activation llv05208   Chemical carcinogenesis - reactive oxygen species llv05210   Colorectal cancer llv05224   Breast cancer llv05231   Choline metabolism in cancer llv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer llv05323   Rheumatoid arthritis llv05417   Lipid and atherosclerosis llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125105343    04668 TNF signaling pathway     125105343    04024 cAMP signaling pathway     125105343  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     125105343  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     125105343    04660 T cell receptor signaling pathway     125105343    04658 Th1 and Th2 cell differentiation     125105343    04659 Th17 cell differentiation     125105343    04657 IL-17 signaling pathway     125105343    04662 B cell receptor signaling pathway     125105343   09152 Endocrine system    04915 Estrogen signaling pathway     125105343    04917 Prolactin signaling pathway     125105343    04921 Oxytocin signaling pathway     125105343    04926 Relaxin signaling pathway     125105343    04935 Growth hormone synthesis, secretion and action     125105343    04928 Parathyroid hormone synthesis, secretion and action     125105343   09156 Nervous system    04725 Cholinergic synapse     125105343    04728 Dopaminergic synapse     125105343   09158 Development and regeneration    04380 Osteoclast differentiation     125105343   09159 Environmental adaptation    04713 Circadian entrainment     125105343  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125105343    05207 Chemical carcinogenesis - receptor activation     125105343    05208 Chemical carcinogenesis - reactive oxygen species     125105343    05231 Choline metabolism in cancer     125105343    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125105343   09162 Cancer: specific types    05210 Colorectal cancer     125105343    05224 Breast cancer     125105343   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     125105343    05170 Human immunodeficiency virus 1 infection     125105343    05161 Hepatitis B     125105343    05171 Coronavirus disease - COVID-19     125105343    05162 Measles     125105343    05167 Kaposi sarcoma-associated herpesvirus infection     125105343   09171 Infectious disease: bacterial    05132 Salmonella infection     125105343    05135 Yersinia infection     125105343    05133 Pertussis     125105343   09174 Infectious disease: parasitic    05140 Leishmaniasis     125105343    05142 Chagas disease     125105343   09163 Immune disease    05323 Rheumatoid arthritis     125105343   09165 Substance dependence    05031 Amphetamine addiction     125105343   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125105343    05418 Fluid shear stress and atherosclerosis     125105343   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     125105343   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     125105343  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:llv03000]     125105343    04131 Membrane trafficking [BR:llv04131]     125105343 Transcription factors [BR:llv03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     125105343 Membrane trafficking [BR:llv04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     125105343 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  125105343 NCBI-ProteinID:  XP_047594689 LinkDB All DBs Position 7:complement(131968591..131972037) Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDNLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVVKTMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSISSVELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGLGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgattacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacaacctctcctactaccactcaccggccgactccttctccagcatg ggctcgccggtcaatgcgcaggacttctgcacggatctggccgtctccagtgccaacttt atcccgacggtgactgccatctccaccagcccggacctgcagtggctggtgcagcccacc ctggtctcctccgtggccccatcacagaccagagccccccatccctatggagtcccgacc ccctctgctggggcttactccagggctggagtcgtgaagaccatgaccggaggcagagct cagagcatcggccggaggggcaaggtggaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaagtgccggaaccgaaggagggag ctgacggacacactccaagcggaaacagaccaactggaggatgagaagtctgctttgcag accgagattgccaacctgctgaaggagaaggagaagctagagttcatcctggcagctcac cgacctgcctgcaagatccccgatgacctgggcttccccgaagagatgtctgtggcttcc ctcgatctgagcgggggcctgcccgaagctgccacccctgagtcggaggaggccttcacc ctgcccctcctcaatgatcccgagcccaagccctccgttgagccagtcaagagtatcagc agtgtggagctcaaggccgagccctttgatgacttcctgttcccagcatcgtccaggccc agtggctctgagacggcccgctccgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggttggggcccatggccacagagctg gagcccctgtgcacccccgtggtcacctgtactcccagctgcactacctacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgctcaccgcaag ggcagcagcagcaacgaaccctcctctgactcgctcagctcacccacactgctggccctg tga

DBGET integrated database retrieval system