Lutra lutra (Eurasian river otter): 125106731 Help Entry 125106731         CDS       T08100                                  Name (RefSeq) RING-box protein 1b isoform X1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism llv  Lutra lutra (Eurasian river otter) Pathway llv03420   Nucleotide excision repair llv04066   HIF-1 signaling pathway llv04110   Cell cycle llv04114   Oocyte meiosis llv04120   Ubiquitin mediated proteolysis llv04141   Protein processing in endoplasmic reticulum llv04310   Wnt signaling pathway llv04350   TGF-beta signaling pathway llv04710   Circadian rhythm llv05170   Human immunodeficiency virus 1 infection llv05200   Pathways in cancer llv05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:llv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     125106731    04120 Ubiquitin mediated proteolysis     125106731   09124 Replication and repair    03420 Nucleotide excision repair     125106731  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     125106731    04350 TGF-beta signaling pathway     125106731    04066 HIF-1 signaling pathway     125106731  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     125106731    04114 Oocyte meiosis     125106731  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     125106731  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125106731   09162 Cancer: specific types    05211 Renal cell carcinoma     125106731   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     125106731  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:llv04121]     125106731    03400 DNA repair and recombination proteins [BR:llv03400]     125106731 Enzymes [BR:llv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      125106731 Ubiquitin system [BR:llv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    125106731   Multi subunit type E3    SCF complex     Ring finger protein      125106731    Cul2 complex      125106731    Cul3 complex      125106731    Cul4 complex      125106731    Cul7 complex      125106731    Cul8 complex      125106731    Cul9 complex      125106731 DNA repair and recombination proteins [BR:llv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       125106731     TCR (transcription coupled repair) factors      Cul4-CSA complex       125106731 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  125106731 NCBI-ProteinID:  XP_047597168 LinkDB All DBs Position 8:137068287..137083358 Genome browser AA seq 111 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLSCFSLPLH LSLAQNTAGVSVGQQRVGIPKVRALEREFFHRAQLFCYSFNDLPSCYLIIN NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat aactgtgccatctgcaggaaccacattatggatctttcatgcttttcacttccattgcat ctctcgctggctcaaaacacggcaggtgtgtccgttggacaacagagagtgggaattcca aaagtacgggcactagagagagaattcttccatcgagctcaactgttctgttattcattt aatgacttgccctcctgttacttaattataaattag

DBGET integrated database retrieval system