Lutra lutra (Eurasian river otter): 125107054 Help Entry 125107054         CDS       T08100                                  Name (RefSeq) interferon gamma   KO K04687   interferon gamma Organism llv  Lutra lutra (Eurasian river otter) Pathway llv03050   Proteasome llv04060   Cytokine-cytokine receptor interaction llv04066   HIF-1 signaling pathway llv04217   Necroptosis llv04350   TGF-beta signaling pathway llv04380   Osteoclast differentiation llv04612   Antigen processing and presentation llv04630   JAK-STAT signaling pathway llv04650   Natural killer cell mediated cytotoxicity llv04657   IL-17 signaling pathway llv04658   Th1 and Th2 cell differentiation llv04659   Th17 cell differentiation llv04660   T cell receptor signaling pathway llv04940   Type I diabetes mellitus llv05140   Leishmaniasis llv05142   Chagas disease llv05143   African trypanosomiasis llv05144   Malaria llv05145   Toxoplasmosis llv05146   Amoebiasis llv05152   Tuberculosis llv05160   Hepatitis C llv05164   Influenza A llv05168   Herpes simplex virus 1 infection llv05200   Pathways in cancer llv05235   PD-L1 expression and PD-1 checkpoint pathway in cancer llv05321   Inflammatory bowel disease llv05322   Systemic lupus erythematosus llv05323   Rheumatoid arthritis llv05330   Allograft rejection llv05332   Graft-versus-host disease llv05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     125107054  09130 Environmental Information Processing   09132 Signal transduction    04350 TGF-beta signaling pathway     125107054    04630 JAK-STAT signaling pathway     125107054    04066 HIF-1 signaling pathway     125107054   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125107054  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     125107054  09150 Organismal Systems   09151 Immune system    04650 Natural killer cell mediated cytotoxicity     125107054    04612 Antigen processing and presentation     125107054    04660 T cell receptor signaling pathway     125107054    04658 Th1 and Th2 cell differentiation     125107054    04659 Th17 cell differentiation     125107054    04657 IL-17 signaling pathway     125107054   09158 Development and regeneration    04380 Osteoclast differentiation     125107054  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     125107054    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     125107054   09172 Infectious disease: viral    05160 Hepatitis C     125107054    05164 Influenza A     125107054    05168 Herpes simplex virus 1 infection     125107054   09171 Infectious disease: bacterial    05152 Tuberculosis     125107054   09174 Infectious disease: parasitic    05146 Amoebiasis     125107054    05144 Malaria     125107054    05145 Toxoplasmosis     125107054    05140 Leishmaniasis     125107054    05142 Chagas disease     125107054    05143 African trypanosomiasis     125107054   09163 Immune disease    05322 Systemic lupus erythematosus     125107054    05323 Rheumatoid arthritis     125107054    05321 Inflammatory bowel disease     125107054    05330 Allograft rejection     125107054    05332 Graft-versus-host disease     125107054   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     125107054   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     125107054  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03051 Proteasome [BR:llv03051]     125107054   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:llv04052]     125107054    00536 Glycosaminoglycan binding proteins [BR:llv00536]     125107054 Proteasome [BR:llv03051]  Eukaryotic proteasome   Assembling factors    Other assembling factors     125107054 Cytokines and neuropeptides [BR:llv04052]  Cytokines   Interferons    125107054 Glycosaminoglycan binding proteins [BR:llv00536]  Heparan sulfate / Heparin   Cytokines    125107054 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IFN-gamma DUF7774 Motif Other DBs NCBI-GeneID:  125107054 NCBI-ProteinID:  XP_047597621 LinkDB All DBs Position 8:complement(95731717..95736586) Genome browser AA seq 166 aa AA seqDB search MNYTNYILAFQLCVIFCSSGYYCQAMFFKEIEDLKEYFNASNPDVADGGPLFLDILKNWR EESDKTIIQSQIVSFYLKLFENFKDNQIIQRSMDTIKEDMLVRFFNSSSSKREDFLKLIR IPVNDLQVQRKAINELIKVMNDLSPRSNLRKRKRSHSVFPGRRASK NT seq 501 nt NT seq  +upstreamnt  +downstreamnt atgaattatacaaactatatcttagcttttcagctttgcgtgattttctgttcttctggc tattattgccaggccatgttttttaaagaaatagaagacctaaaggaatattttaatgca agtaatccagatgtagcagatggtggccctcttttcttagatattttgaagaactggaga gaggagagtgacaaaacaatcattcaaagccaaattgtctccttctacttgaaactgttt gaaaactttaaagataaccagatcattcaaaggagcatggataccatcaaggaagacatg cttgtcaggttcttcaatagcagcagcagtaagcgggaggacttccttaagctgattcga attcccgtgaatgatctgcaggtccagcgcaaagcgataaatgaactcatcaaagtgatg aatgatctctcaccaagatctaacctaaggaagcggaaaaggagtcacagtgtgtttccc ggccgcagagcatcgaaataa

DBGET integrated database retrieval system