Lutra lutra (Eurasian river otter): 125107556 Help Entry 125107556         CDS       T08100                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism llv  Lutra lutra (Eurasian river otter) Pathway llv04010   MAPK signaling pathway llv04014   Ras signaling pathway llv04015   Rap1 signaling pathway llv04024   cAMP signaling pathway llv04062   Chemokine signaling pathway llv04510   Focal adhesion llv04517   IgSF CAM signaling llv04520   Adherens junction llv04611   Platelet activation llv04670   Leukocyte transendothelial migration llv04720   Long-term potentiation llv04722   Neurotrophin signaling pathway llv04934   Cushing syndrome llv04972   Pancreatic secretion llv05211   Renal cell carcinoma llv05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:llv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125107556    04014 Ras signaling pathway     125107556    04015 Rap1 signaling pathway     125107556    04024 cAMP signaling pathway     125107556   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     125107556  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     125107556    04520 Adherens junction     125107556  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     125107556    04670 Leukocyte transendothelial migration     125107556    04062 Chemokine signaling pathway     125107556   09154 Digestive system    04972 Pancreatic secretion     125107556   09156 Nervous system    04720 Long-term potentiation     125107556    04722 Neurotrophin signaling pathway     125107556  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     125107556   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     125107556   09167 Endocrine and metabolic disease    04934 Cushing syndrome     125107556  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:llv04147]     125107556    04031 GTP-binding proteins [BR:llv04031]     125107556 Exosome [BR:llv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125107556   Exosomal proteins of other body fluids (saliva and urine)    125107556   Exosomal proteins of colorectal cancer cells    125107556 GTP-binding proteins [BR:llv04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     125107556 SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  125107556 NCBI-ProteinID:  XP_047598742 LinkDB All DBs Position 8:96130098..96174053 Genome browser AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKRST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttactgcaatgagagatttatacatgaaaaatggccaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcagatt cttcgagttaaagacactgatgatgttccgatgatcctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcagaacctagcaagacagtggaacaac tgtgcattcttagaatcttctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaaggcccgcaaaaggtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system