Leishmania major: LMJF_24_1610 Help Entry LMJF_24_1610      CDS       T01014                                  Name (RefSeq) putative ring-box protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lma  Leishmania major Pathway lma03420   Nucleotide excision repair lma04120   Ubiquitin mediated proteolysis lma04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lma00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     LMJF_24_1610    04120 Ubiquitin mediated proteolysis     LMJF_24_1610   09124 Replication and repair    03420 Nucleotide excision repair     LMJF_24_1610  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lma04121]     LMJF_24_1610    03400 DNA repair and recombination proteins [BR:lma03400]     LMJF_24_1610 Enzymes [BR:lma01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      LMJF_24_1610 Ubiquitin system [BR:lma04121]  Ubiquitin ligases (E3)   UBL E3 ligases    LMJF_24_1610   Multi subunit Ring-finger type E3    SCF complex     Ring finger protein      LMJF_24_1610    Cul2 complex      LMJF_24_1610    Cul3 complex      LMJF_24_1610    Cul4 complex      LMJF_24_1610    Cul7 complex      LMJF_24_1610    Cul8 complex      LMJF_24_1610    Cul9 complex      LMJF_24_1610 DNA repair and recombination proteins [BR:lma03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       LMJF_24_1610     TCR (transcription coupled repair) factors      Cul4-CSA complex       LMJF_24_1610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_16 zf-RING_11 FANCL_C Motif Other DBs NCBI-GeneID:  5652328 NCBI-ProteinID:  XP_001683678 UniProt:  Q4QAH0 LinkDB All DBs Position 24:605064..605423 Genome browser AA seq 119 aa AA seqDB search MSAEPTSTTAAASNAAPPQALMPGGRQLFTVEEFYPVYFSAWERETGLCSICCNQVEGPC VVCQSNAEATSAECSITWGECGHAFHTHCIEKWLKTRPVCPLDNKEWKDRSDWNTSATV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcagctgaacccacttctaccactgccgctgcttctaatgcagcaccaccacaagcg ttaatgccgggaggccggcaactcttcaccgtggaggagttctacccggtctacttctct gcctgggagcgtgagacgggtctgtgtagcatctgctgcaaccaagtcgaggggccgtgc gtcgtgtgccagagcaacgcggaggccacctcggcggagtgcagcatcacatggggcgag tgcggccatgccttccatacccattgcattgagaaatggctgaagacgcggccagtgtgc ccgctcgacaacaaggagtggaaagaccgctcagactggaacacctccgccaccgtatag

DBGET integrated database retrieval system