Leptotrichia mesophila: AB8B23_02155 Help Entry AB8B23_02155      CDS       T10902                                  Name (GenBank) ferredoxin family protein   KO K00395   adenylylsulfate reductase, subunit B [EC:1.8.99.2] Organism lmes  Leptotrichia mesophila Pathway lmes00920   Sulfur metabolism lmes01100   Metabolic pathways lmes01120   Microbial metabolism in diverse environments lmes01320   Sulfur cycle Brite KEGG Orthology (KO) [BR:lmes00001]  09100 Metabolism   09102 Energy metabolism    00920 Sulfur metabolism     AB8B23_02155 Enzymes [BR:lmes01000]  1. Oxidoreductases   1.8  Acting on a sulfur group of donors    1.8.99  With unknown physiological acceptors     1.8.99.2  adenylyl-sulfate reductase      AB8B23_02155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_10 Fer4_21 Fer4_9 Fer4 Fer4_16 Fer4_6 Fer4_4 Fer4_2 Fer4_8 Fer4_3 Fer4_22 SCO1-SenC Fer4_18 Motif Other DBs NCBI-ProteinID:  XDU64982 UniProt:  A0AB39VC85 LinkDB All DBs Position 443681..444010 Genome browser AA seq 109 aa AA seqDB search MSIVIDPYVCIGCTKCTLVCPGTLIEMQKVDDMKIEKAVMQYPKDCWGCVSCVKECPVQA ISFFLGADIGGNGSTMTTKEEGDVLKWIIEKRDGTVEEIDINRKDANKY NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgagcatagtaattgatccgtatgtgtgtataggatgtacaaaatgtacgctggtatgt ccagggactttaattgaaatgcagaaagtggatgacatgaaaattgaaaaggcggttatg caatatccgaaagattgctggggctgtgtttcctgcgtgaaggaatgcccagttcaggca atttcatttttccttggggcagatattggcggaaatggaagcacaatgacaacgaaggaa gaaggagatgttctgaaatggattattgaaaaaagagacggaactgtggaggaaattgat ataaacaggaaagatgcgaataaatattga

DBGET integrated database retrieval system