Labrus mixtus (cuckoo wrasse): 132972561 Help Entry 132972561         CDS       T10666                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism lmix  Labrus mixtus (cuckoo wrasse) Pathway lmix00510   N-Glycan biosynthesis lmix00513   Various types of N-glycan biosynthesis lmix04141   Protein processing in endoplasmic reticulum Module lmix_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:lmix00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     132972561 (tmem258)    00513 Various types of N-glycan biosynthesis     132972561 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     132972561 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Motif Other DBs NCBI-GeneID:  132972561 NCBI-ProteinID:  XP_060891463 LinkDB All DBs Position 4:complement(7262575..7265861) Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaactcgaagctatgaccagatacaccagcccggtgaacccggctgtgttccctcac ctcacagtcgtcctgctggccatcggcatgttcttcactgcctggttcttcgtctacgag gtgacatcaacaaaatatacccgggatgtctacaaagagttactgatctcccttgtggca tcacttttcatgggcttcggtgtgctgttcttactactctgggttgggatctacgtatga

DBGET integrated database retrieval system