Listeria monocytogenes M7 (serotype 4a): LMM7_1967 Help Entry LMM7_1967         CDS       T01988                                  Symbol folA Name (GenBank) dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism lmq  Listeria monocytogenes M7 (serotype 4a) Pathway lmq00670   One carbon pool by folate lmq00790   Folate biosynthesis lmq01100   Metabolic pathways lmq01240   Biosynthesis of cofactors lmq04981   Folate transport and metabolism Brite KEGG Orthology (KO) [BR:lmq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LMM7_1967 (folA)    00670 One carbon pool by folate     LMM7_1967 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     LMM7_1967 (folA) Enzymes [BR:lmq01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      LMM7_1967 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  AEH92972 UniProt:  A0A0E0UWZ8 LinkDB All DBs Position complement(1958407..1958889) Genome browser AA seq 160 aa AA seqDB search MIIFVWAQDRAGNIGKDNKMPWHLPGDLQFFKKTTTGKTLVMGRKTYESLGKALPNRKTI VLTRDQGLKLDDAEILHSKEAVLALAETGEPIYIVGGAEIYRLFMDVADQLIVTKIDAEF EADTAFPKVDWENFSEVAKEFHEKDEKNKYNYTFYTYERN NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgattatttttgtttgggcacaagaccgcgctggtaatattggaaaagataacaaaatg ccgtggcacttaccaggagatttgcagtttttcaaaaaaacgacgactgggaaaacactt gtcatggggcgaaaaacctatgaatcgttaggaaaagctttaccaaatagaaagacaatc gtattgacacgagatcaaggtctcaagttagatgatgcagagatacttcattcaaaagaa gctgttctagcccttgctgagacaggggaaccaatctatatagttggtggtgcagaaatc tatcgtttatttatggatgtggcggatcagctgattgtgacaaaaattgatgcagagttt gaggctgatactgcgtttcctaaagtggattgggagaatttttccgaagtggcgaaagaa ttccatgaaaaagatgaaaaaaataagtacaattacactttttatacgtatgaaagaaat tag

DBGET integrated database retrieval system