Lagopus muta (rock ptarmigan): 125693556 Help Entry 125693556         CDS       T09141                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism lmut  Lagopus muta (rock ptarmigan) Pathway lmut04060   Cytokine-cytokine receptor interaction lmut04672   Intestinal immune network for IgA production lmut04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:lmut00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     125693556 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     125693556 (CXCL12)  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     125693556 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lmut04052]     125693556 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:lmut00536]     125693556 (CXCL12) Cytokines and neuropeptides [BR:lmut04052]  Cytokines   Chemokines    125693556 (CXCL12) Glycosaminoglycan binding proteins [BR:lmut00536]  Heparan sulfate / Heparin   Chemokines    125693556 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  125693556 NCBI-ProteinID:  XP_048801636 LinkDB All DBs Position 5:complement(49360892..49378227) Genome browser AA seq 131 aa AA seqDB search MDLRALALLAFALAVISLSEEKPVSLTYRCPCRFFESNVARANIKHLKILSTPNCSLQIV ARLKSNSKQVCIDPKLKWIQEYLEKALNKPRHRTHKKKQQKKRGPLCPSRATPLKSPGRK NGGSRCKRQAL NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggaccttcgcgctctggctctgctcgcctttgccctggcggtcatctccctgtctgag gagaagcccgtcagcctgacgtaccgatgcccctgtcgattcttcgagagcaacgtggcg agagccaacattaaacacctcaaaatcctctccacccccaactgctcacttcagattgtt gcaaggctcaagagcaacagcaagcaagtgtgcattgatcccaagctaaagtggatccag gaatatctggaaaaagctttaaacaaaccacgtcatcgcactcataaaaaaaagcaacag aagaaacggggcccactctgcccttcccgtgcaacaccactaaagtctccagggagaaag aatggaggttcaagatgtaagaggcaagcattgtaa

DBGET integrated database retrieval system