Loa loa (eye worm): LOAG_03239 Help Entry LOAG_03239        CDS       T02664                                  Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism loa  Loa loa (eye worm) Pathway loa03420   Nucleotide excision repair loa04120   Ubiquitin mediated proteolysis loa04141   Protein processing in endoplasmic reticulum loa04310   Wnt signaling pathway loa04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:loa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     LOAG_03239    04120 Ubiquitin mediated proteolysis     LOAG_03239   09124 Replication and repair    03420 Nucleotide excision repair     LOAG_03239  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     LOAG_03239    04350 TGF-beta signaling pathway     LOAG_03239  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:loa04121]     LOAG_03239    03400 DNA repair and recombination proteins [BR:loa03400]     LOAG_03239 Enzymes [BR:loa01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      LOAG_03239 Ubiquitin system [BR:loa04121]  Ubiquitin ligases (E3)   UBL E3 ligases    LOAG_03239   Multi subunit type E3    SCF complex     Ring finger protein      LOAG_03239    Cul2 complex      LOAG_03239    Cul3 complex      LOAG_03239    Cul4 complex      LOAG_03239    Cul7 complex      LOAG_03239    Cul8 complex      LOAG_03239    Cul9 complex      LOAG_03239 DNA repair and recombination proteins [BR:loa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       LOAG_03239     TCR (transcription coupled repair) factors      Cul4-CSA complex       LOAG_03239 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  9940626 NCBI-ProteinID:  XP_003138824 UniProt:  A0A1I7VGS5 LinkDB All DBs AA seq 117 aa AA seqDB search MSVSGAQQMELDDVQQPSGTPSISSKEKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMD LCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgtaagcggagcacaacagatggaattggatgatgtgcagcaaccttccggcacc ccaagtatttctagcaaagaaaagaaacgctttgaggtgaagaaatggaatgcagtagcg ctgtgggcttgggatatagtagttgataattgcgcaatttgtcggaaccatattatggac ctctgtatcgaatgtcaagcaaaccaagcttcagcaacttccgaagaatgcacagttgca tggggtgtatgcaatcatgcatttcattttcactgtatttcacgttggcttaagacacgt caagtgtgtcctcttgataatagagagtgggagtttcaaaagtatggtcattag

DBGET integrated database retrieval system