Lepisosteus oculatus (spotted gar): 102687759 Help Entry 102687759         CDS       T07349                                  Name (RefSeq) thymosin beta-12-like isoform X1   KO K05764   thymosin, beta 4 Organism loc  Lepisosteus oculatus (spotted gar) Pathway loc04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:loc00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102687759  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:loc04812]     102687759 Cytoskeleton proteins [BR:loc04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Thymosin      102687759 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thymosin DUF4522 Motif Other DBs NCBI-GeneID:  102687759 NCBI-ProteinID:  XP_006631822 Ensembl:  ENSLOCG00000009797 LinkDB All DBs Position LG6:complement(23083749..23087430) Genome browser AA seq 50 aa AA seqDB search MFQAKMSDKPDLTEIEGFDKSKLKKTETKEKNPLPTKETIEQERKGEAAL NT seq 153 nt NT seq  +upstreamnt  +downstreamnt atgttccaggcaaagatgtctgacaagccagatctcacggaaatcgaaggtttcgacaaa tctaagctgaagaagacggaaaccaaagagaagaaccccttgccaacaaaggagacaatt gaacaggagcggaagggagaagctgctctttga

DBGET integrated database retrieval system