Leishmania orientalis: 92361329 Help Entry 92361329          CDS       T10351                                  Symbol LSCM4_05455 Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism loi  Leishmania orientalis Pathway loi03420   Nucleotide excision repair loi04120   Ubiquitin mediated proteolysis loi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:loi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     92361329 (LSCM4_05455)    04120 Ubiquitin mediated proteolysis     92361329 (LSCM4_05455)   09124 Replication and repair    03420 Nucleotide excision repair     92361329 (LSCM4_05455)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:loi04121]     92361329 (LSCM4_05455)    03400 DNA repair and recombination proteins [BR:loi03400]     92361329 (LSCM4_05455) Enzymes [BR:loi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      92361329 (LSCM4_05455) Ubiquitin system [BR:loi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    92361329 (LSCM4_05455)   Multi subunit type E3    SCF complex     Ring finger protein      92361329 (LSCM4_05455)    Cul2 complex      92361329 (LSCM4_05455)    Cul3 complex      92361329 (LSCM4_05455)    Cul4 complex      92361329 (LSCM4_05455)    Cul7 complex      92361329 (LSCM4_05455)    Cul8 complex      92361329 (LSCM4_05455)    Cul9 complex      92361329 (LSCM4_05455) DNA repair and recombination proteins [BR:loi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       92361329 (LSCM4_05455)     TCR (transcription coupled repair) factors      Cul4-CSA complex       92361329 (LSCM4_05455) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 PHD_NSD zf-RING_16 zf_RING_Vps8_fungal zf-RING_11 Motif Other DBs NCBI-GeneID:  92361329 NCBI-ProteinID:  XP_067062963 UniProt:  A0A836KKV9 LinkDB All DBs Position 24:<642518..>642877 Genome browser AA seq 119 aa AA seqDB search MSAEPSAASATASNAAPSSALMPGGQQLFTVEEFYPVYFSAWERETGLCSICCNQVEGPC VVCQSNAEATSAECSITWGECGHAFHTHCIEKWLKTRPVCPLDNKEWKDRSDWNTSAAV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtcagccgagccttccgctgcctctgcaactgcttctaatgcagcgccgtcatcagca ttgatgccgggtggccagcagctcttcacagtggaagagttttacccagtgtacttctcg gcctgggagcgcgagacgggcctgtgcagcatctgctgcaaccaagttgaagggccgtgc gtcgtatgccaaagcaacgcagaggccacttcagcggagtgcagcattacgtggggtgag tgcggccacgcttttcacacccactgcattgagaaatggttgaagacgcggccggtgtgc ccgctcgacaacaaagagtggaaggatcgctcagactggaacacctccgccgctgtgtag

DBGET integrated database retrieval system