Leishmania orientalis: 92361576 Help Entry 92361576          CDS       T10351                                  Symbol LSCM4_05710 Name (RefSeq) hypothetical protein   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism loi  Leishmania orientalis Pathway loi03420   Nucleotide excision repair loi04120   Ubiquitin mediated proteolysis loi04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:loi00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     92361576 (LSCM4_05710)    04120 Ubiquitin mediated proteolysis     92361576 (LSCM4_05710)   09124 Replication and repair    03420 Nucleotide excision repair     92361576 (LSCM4_05710)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:loi04121]     92361576 (LSCM4_05710)    03400 DNA repair and recombination proteins [BR:loi03400]     92361576 (LSCM4_05710) Enzymes [BR:loi01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      92361576 (LSCM4_05710) Ubiquitin system [BR:loi04121]  Ubiquitin ligases (E3)   UBL E3 ligases    92361576 (LSCM4_05710)   Multi subunit type E3    SCF complex     Ring finger protein      92361576 (LSCM4_05710)    Cul2 complex      92361576 (LSCM4_05710)    Cul3 complex      92361576 (LSCM4_05710)    Cul4 complex      92361576 (LSCM4_05710)    Cul7 complex      92361576 (LSCM4_05710)    Cul8 complex      92361576 (LSCM4_05710)    Cul9 complex      92361576 (LSCM4_05710) DNA repair and recombination proteins [BR:loi03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       92361576 (LSCM4_05710)     TCR (transcription coupled repair) factors      Cul4-CSA complex       92361576 (LSCM4_05710) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Motif Other DBs NCBI-GeneID:  92361576 NCBI-ProteinID:  XP_067063415 UniProt:  A0A836KL79 LinkDB All DBs Position 21:<17399..>17719 Genome browser AA seq 106 aa AA seqDB search MQTKDEARTSSLVDGSKGNRFQLKKWNAVALWSWDIQVDTCAICRNHIMDLCIECQSNPS CSPKDCTVAWGACNHAFHMHCISRWLKTRNVCPLDNKEWVYLRYGA NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgcagacgaaagatgaagcgcgcacatccagtttggtggatggcagcaagggaaatcgt tttcagctgaaaaaatggaacgcagttgcgctttggtcctgggacatccaggtggacacc tgcgcaatatgtagaaaccacatcatggatttgtgcatcgagtgtcagtcgaatccatcc tgctcgccaaaggactgcacggttgcctggggtgcttgcaatcatgccttccatatgcac tgcatatctcggtggctgaagactcgcaatgtgtgtcctttagacaataaagagtgggtt taccttcgatacggcgcatga

DBGET integrated database retrieval system