Lolium perenne (perennial ryegrass): 127297635 Help Entry 127297635         CDS       T08650                                  Name (RefSeq) uncharacterized protein   KO K07936   GTP-binding nuclear protein Ran Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03008   Ribosome biogenesis in eukaryotes lper03013   Nucleocytoplasmic transport lper03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     127297635    03008 Ribosome biogenesis in eukaryotes     127297635   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     127297635  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lper03019]     127297635    03009 Ribosome biogenesis [BR:lper03009]     127297635    03016 Transfer RNA biogenesis [BR:lper03016]     127297635    03036 Chromosome and associated proteins [BR:lper03036]     127297635   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lper04147]     127297635    04031 GTP-binding proteins [BR:lper04031]     127297635 Messenger RNA biogenesis [BR:lper03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      127297635 Ribosome biogenesis [BR:lper03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     127297635   Pre-60S particles     127297635 Transfer RNA biogenesis [BR:lper03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     127297635 Chromosome and associated proteins [BR:lper03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      127297635    Spindle formation proteins     127297635 Exosome [BR:lper04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127297635 GTP-binding proteins [BR:lper04031]  Small (monomeric) G-proteins   Ran Family    Ran     127297635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  127297635 NCBI-ProteinID:  XP_071674489 LinkDB All DBs Position 4:complement(396008810..396015361) Genome browser AA seq 170 aa AA seqDB search MEGLAALRLTYKNVPTWCRELCRVCESVRANKSHSTRRRTCSATKSLPRETTTLRSPSLT LQGSLPDNFLRSSMAPITSRGSLACESVLPSGASRGHLYCNPPGRSRHCLSHDVVRIVGR DNGTKVNVMLGGIHVNMCQLLLGLFLDVLREKPRYTTPYLRLVSFPYFSY NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggaagggcttgcagctctgaggctgacttacaagaatgttcctacttggtgcagagag ttgtgtagggtgtgtgagtctgtgagagcaaacaagtcacattccacaagacggagaacc tgcagtgctacgaagtctctgccaagagaaactacaactttgagaagcccttcccttacc ttgcaaggaagtttgccggataattttcttcgctcgtcaatggctccaataacgtccaga gggagcttggcttgtgagtccgttctgccctccggagcaagtaggggtcatctttattgc aacccacctgggagaagtaggcattgtctctctcatgatgtggtgcgaattgtcgggcga gacaatggtacaaaggttaacgttatgttgggtgggattcatgtaaacatgtgtcagcta ttgctcggattgttcctcgatgtgctccgcgagaaacccaggtacaccacgccctacctt cggcttgtgtcttttccctatttttcttattga

DBGET integrated database retrieval system