Lolium perenne (perennial ryegrass): 127313222 Help Entry 127313222         CDS       T08650                                  Name (RefSeq) uncharacterized protein   KO K26502   transmembrane protein 258 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper00510   N-Glycan biosynthesis lper00513   Various types of N-glycan biosynthesis lper04141   Protein processing in endoplasmic reticulum Module lper_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:lper00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     127313222    00513 Various types of N-glycan biosynthesis     127313222  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127313222 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6338 Motif Other DBs NCBI-GeneID:  127313222 NCBI-ProteinID:  XP_051199736 LinkDB All DBs Position 7:247925584..247928594 Genome browser AA seq 76 aa AA seqDB search MAAKAISSPVPVEWYPTLAVVMVSVGLMLTASFFIYEATTSRRNRSLAKEIVTASVASVF LGFGSLFVLLASGVYV NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcggcgaaggcgatctcgagccccgtgccggtggaatggtacccgacgctggccgtc gtcatggtctccgtcggcctcatgctcaccgcctccttcttcatttatgaagccacgact tcaaggcggaaccgtagtttagcaaaggagatagtcacagcatctgttgcttctgtcttt ctgggctttggatctctgttcgtgctccttgcaagcggtgtttatgtctga

DBGET integrated database retrieval system