Lolium perenne (perennial ryegrass): 127341399 Help Entry 127341399         CDS       T08650                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03420   Nucleotide excision repair lper04120   Ubiquitin mediated proteolysis lper04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127341399    04120 Ubiquitin mediated proteolysis     127341399   09124 Replication and repair    03420 Nucleotide excision repair     127341399  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lper04121]     127341399    03400 DNA repair and recombination proteins [BR:lper03400]     127341399 Enzymes [BR:lper01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      127341399 Ubiquitin system [BR:lper04121]  Ubiquitin ligases (E3)   UBL E3 ligases    127341399   Multi subunit type E3    SCF complex     Ring finger protein      127341399    Cul2 complex      127341399    Cul3 complex      127341399    Cul4 complex      127341399    Cul7 complex      127341399    Cul8 complex      127341399    Cul9 complex      127341399 DNA repair and recombination proteins [BR:lper03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       127341399     TCR (transcription coupled repair) factors      Cul4-CSA complex       127341399 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  127341399 NCBI-ProteinID:  XP_051223193 LinkDB All DBs Position 3:complement(45570174..45573562) Genome browser AA seq 125 aa AA seqDB search MSAMETDAADVKPPLLPAPAAEGSSAAGPSSSRKPAKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacgccgccgacgtgaagccgccgctcctccccgcccccgcc gccgagggctcctccgccgccgggccctcctcctcccgcaagcccgccaagcgcttcgag atcaagaagtggaacgccgtcgcgctctgggcgtgggatatcgtggtcgacaactgcgcc atctgccgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaggccagcgcc accagcgaggagtgcaccgtcgcgtggggtgtctgcaatcatgctttccacttccactgc atcagcaggtggctcaagactcgccaagtgtgcccattagacaacagcgaatgggaattc cagaaatatggccactag

DBGET integrated database retrieval system