Lolium perenne (perennial ryegrass): 127344263 Help Entry 127344263         CDS       T08650                                  Name (RefSeq) sm-like protein LSM3B   KO K12622   U6 snRNA-associated Sm-like protein LSm3 Organism lper  Lolium perenne (perennial ryegrass) Pathway lper03018   RNA degradation lper03040   Spliceosome Brite KEGG Orthology (KO) [BR:lper00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     127344263   09123 Folding, sorting and degradation    03018 RNA degradation     127344263  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:lper03019]     127344263    03041 Spliceosome [BR:lper03041]     127344263 Messenger RNA biogenesis [BR:lper03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      127344263   mRNA degradation factors    5'-3' decay     Lsm complex      127344263 Spliceosome [BR:lper03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     127344263  Complex C   U2 snRNP components     127344263 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM TIG_SUH Glutaredoxin Motif Other DBs NCBI-GeneID:  127344263 NCBI-ProteinID:  XP_051226454 LinkDB All DBs Position 3:complement(284504108..284506398) Genome browser AA seq 98 aa AA seqDB search MASAEEEIAVKEPLDLIRLSLDERIYVKLRSDRELRGKLHAYDQHLNMILGDVEEIVTTV EIDDETYEEIVRTTRRTIPFLFVRGDGVILVSPPLRTA NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcgtcagcggaggaggagatcgcggtgaaggagcccctggatctgataaggctcagc ctcgacgagcgcatctacgtcaagctccgctccgaccgcgagctccgcggcaagctccat gcatatgatcagcacttaaacatgatccttggagatgttgaggagattgtaacaactgtt gaaatcgatgatgaaacatatgaagaaatagtgcggactaccaggcgtaccatccccttc ctttttgtccgaggagatggtgttatattggtttctccgcctctgcgaactgcgtga

DBGET integrated database retrieval system