Lytechinus pictus (painted urchin): 129282391 Help Entry 129282391         CDS       T09066                                  Name (RefSeq) snaclec 27-like   KO K06563   C-type lectin domain family 4 member L/M Organism lpic  Lytechinus pictus (painted urchin) Pathway lpic03260   Virion - Human immunodeficiency virus lpic03264   Virion - Flavivirus and Alphavirus lpic03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus lpic03273   Virion - Lassa virus and SFTS virus lpic04145   Phagosome Brite KEGG Orthology (KO) [BR:lpic00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     129282391    03264 Virion - Flavivirus and Alphavirus     129282391    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     129282391    03273 Virion - Lassa virus and SFTS virus     129282391  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     129282391  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:lpic04131]     129282391   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:lpic04054]     129282391    04515 Cell adhesion molecules [BR:lpic04515]     129282391    04090 CD molecules [BR:lpic04090]     129282391    04091 Lectins [BR:lpic04091]     129282391 Membrane trafficking [BR:lpic04131]  Endocytosis   Phagocytosis    C-lectin receptors     129282391 Pattern recognition receptors [BR:lpic04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    129282391 Cell adhesion molecules [BR:lpic04515]  Lectins   Selectins and C-type lectins    129282391 CD molecules [BR:lpic04090]  Proteins   129282391 Lectins [BR:lpic04091]  C-Type lectins   Asialoglycoprotein and DC receptors    129282391 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Lectin_C UL45 Motif Other DBs NCBI-GeneID:  129282391 NCBI-ProteinID:  XP_054774254 LinkDB All DBs Position 19:complement(34898290..34904864) Genome browser AA seq 163 aa AA seqDB search MLRIMCLAALALAVTACPVGWHQSGRSCYKVSQVFATYNDAVRRCAQFSSCETGFGGHLV SITTDFENQQVLDILNYNQMARNETWLGLRTFNGPVFWASGEPLNPRLTNPWHAGNPVRG PNMCTVAFQNRWATRNCNMRRQFICEMGGEAPPPAFLVNQETP NT seq 492 nt NT seq  +upstreamnt  +downstreamnt atgcttcgaattatgtgccttgccgccctggccctagcggtcactgcttgtccggttggg tggcaccaatccggtagatcttgctacaaggtatcacaggtgttcgctacctataacgat gcggtaagaagatgcgcacagtttagttcctgtgagaccggattcgggggacacctggtg tccattacgaccgactttgagaaccaacaggttctggacatcctgaactacaaccagatg gcccggaatgagacctggctcggcctaaggaccttcaacggcccagtcttctgggccagt ggcgaacccctcaatccacgcctcaccaacccatggcatgctggtaatcccgtacgagga cccaatatgtgcaccgtagccttccagaacagatgggcaacaaggaattgtaacatgagg agacagttcatctgtgagatgggcggcgaagctccccctcccgcctttttagtcaaccag gaaacaccataa

DBGET integrated database retrieval system