Lonsdalea populi: I6N93_02215 Help Entry I6N93_02215       CDS       T06954                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism lpop  Lonsdalea populi Pathway lpop00670   One carbon pool by folate lpop00790   Folate biosynthesis lpop01100   Metabolic pathways lpop01240   Biosynthesis of cofactors lpop04981   Folate transport and metabolism Module lpop_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:lpop00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     I6N93_02215 (folA)    00670 One carbon pool by folate     I6N93_02215 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     I6N93_02215 (folA) Enzymes [BR:lpop01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      I6N93_02215 (folA) SSDB OrthologParalogGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  QPQ24648 LinkDB All DBs Position 466410..466892 Genome browser AA seq 160 aa AA seqDB search MVISLIAAMAMDRVIGMENAMPWHLPADLAWFKRNTLDKPIVMGRNTFRSIGQPLPGRRN IVISRQPGDDDRVIWVTSPEAALAEAGDVEEVMVIGGGSIYRQMLPLAQRLYLTHIDADV EGDTHFPDYEPDEWRSTFSEFHEADERNSHHYCFEILERR NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atggttattagtttgattgctgcgatggcgatggatcgggttattgggatggaaaatgcc atgccctggcatctccctgccgatctggcgtggttcaagcgcaatacgctcgataagccg attgtgatgggacgcaacacgttccgctccatcggtcagccgctgccgggaaggcgtaat atcgtgatcagccgtcagccgggcgacgatgaccgcgtgatttgggtcacgtcaccggag gccgcgctggccgaggcgggcgatgtcgaagaagttatggtcattggcggcggcagtatc taccgacagatgttgcccctggcgcaacggctttatctgacgcacattgacgccgacgtt gagggcgacacccacttcccggactatgagccggatgagtggcgttccacgttcagtgag tttcatgaagcggatgagcgcaactctcaccactactgcttcgaaatactggagcgtcgc tag

DBGET integrated database retrieval system