Lolium rigidum (rigid ryegrass): 124661924 Help Entry 124661924         CDS       T09103                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03420   Nucleotide excision repair lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124661924    04120 Ubiquitin mediated proteolysis     124661924   09124 Replication and repair    03420 Nucleotide excision repair     124661924  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lrd04121]     124661924    03400 DNA repair and recombination proteins [BR:lrd03400]     124661924 Enzymes [BR:lrd01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      124661924 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   UBL E3 ligases    124661924   Multi subunit type E3    SCF complex     Ring finger protein      124661924    Cul2 complex      124661924    Cul3 complex      124661924    Cul4 complex      124661924    Cul7 complex      124661924    Cul8 complex      124661924    Cul9 complex      124661924 DNA repair and recombination proteins [BR:lrd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       124661924     TCR (transcription coupled repair) factors      Cul4-CSA complex       124661924 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  124661924 NCBI-ProteinID:  XP_047055766 LinkDB All DBs Position 6:268858117..268860867 Genome browser AA seq 125 aa AA seqDB search MSAMETDAADVKPPVAPAPAAEGSSAAGPSSSRKPTKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacgccgccgacgtgaagccgccggtcgcccccgcccccgcc gccgagggctcctccgccgcagggccctcctcctcccgcaagcccaccaagcgcttcgag atcaagaagtggaacgccgtcgccctctgggcatgggatattgtggtcgacaactgcgcc atctgccgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaggccagcgcc accagcgaggagtgcaccgtcgcctggggtgtctgcaatcatgctttccacttccactgc atcagtaggtggctgaagactcgccaagtgtgcccattagacaacagcgaatgggaattc cagaaatatggccactag

DBGET integrated database retrieval system