Lolium rigidum (rigid ryegrass): 124666909 Help Entry 124666909         CDS       T09103                                  Name (RefSeq) RING-box protein 1a-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03420   Nucleotide excision repair lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124666909    04120 Ubiquitin mediated proteolysis     124666909   09124 Replication and repair    03420 Nucleotide excision repair     124666909  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lrd04121]     124666909    03400 DNA repair and recombination proteins [BR:lrd03400]     124666909 Enzymes [BR:lrd01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      124666909 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   UBL E3 ligases    124666909   Multi subunit type E3    SCF complex     Ring finger protein      124666909    Cul2 complex      124666909    Cul3 complex      124666909    Cul4 complex      124666909    Cul7 complex      124666909    Cul8 complex      124666909    Cul9 complex      124666909 DNA repair and recombination proteins [BR:lrd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       124666909     TCR (transcription coupled repair) factors      Cul4-CSA complex       124666909 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  124666909 NCBI-ProteinID:  XP_047060197 LinkDB All DBs Position 6:complement(314361605..314364278) Genome browser AA seq 125 aa AA seqDB search MSAMETDAPDVKPPVAPAPAAEGSSAAGPSSSRKPTKRFEIKKWNAVALWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atgtccgccatggagaccgacgcccccgacgtgaagccgccggtcgcccccgcccccgcc gccgagggctcctccgccgccgggccctcctcctcccgcaagcccaccaagcgcttcgag atcaagaagtggaacgccgtcgccctctgggcgtgggatatcgtggtcgacaactgcgcc atctgccgcaaccacatcatggatctatgcatcgagtgccaggcgaaccaggccagcgcc accagcgaggagtgcaccgtcgcgtggggtgtctgcaatcatgctttccacttccactgc atcagcaggtggctcaagactcgccaagtgtgcccattagacaacagcgaatgggaattc cagaaatatggccactag

DBGET integrated database retrieval system