Lolium rigidum (rigid ryegrass): 124688142 Help Entry 124688142         CDS       T09103                                  Name (RefSeq) RING-box protein 1-like   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lrd  Lolium rigidum (rigid ryegrass) Pathway lrd03420   Nucleotide excision repair lrd04120   Ubiquitin mediated proteolysis lrd04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lrd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124688142    04120 Ubiquitin mediated proteolysis     124688142   09124 Replication and repair    03420 Nucleotide excision repair     124688142  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lrd04121]     124688142    03400 DNA repair and recombination proteins [BR:lrd03400]     124688142 Enzymes [BR:lrd01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      124688142 Ubiquitin system [BR:lrd04121]  Ubiquitin ligases (E3)   UBL E3 ligases    124688142   Multi subunit type E3    SCF complex     Ring finger protein      124688142    Cul2 complex      124688142    Cul3 complex      124688142    Cul4 complex      124688142    Cul7 complex      124688142    Cul8 complex      124688142    Cul9 complex      124688142 DNA repair and recombination proteins [BR:lrd03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       124688142     TCR (transcription coupled repair) factors      Cul4-CSA complex       124688142 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX Motif Other DBs NCBI-GeneID:  124688142 NCBI-ProteinID:  XP_047077813 LinkDB All DBs Position 2:217695571..217699676 Genome browser AA seq 116 aa AA seqDB search MDQGDVAVAVPAAVPSPSCAGAGCKKNKRLEIKKWNAVALWAWDIVVDNCAICRNHIMDL CIECQANQASVTSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggaccagggcgacgtcgccgtggccgtgcccgccgcagtgccctccccgtcctgcgcc ggcgccggctgcaagaagaacaagcgcctcgagatcaagaagtggaacgccgtcgcgctc tgggcctgggacatcgtggtcgacaactgcgccatctgccgcaaccacatcatggacctc tgcatcgagtgccaggcgaaccaggccagcgttaccagcgaggagtgcaccgtcgcttgg ggagtttgcaaccacgccttccacttccactgcatcagccgttggctcaagacccgtcaa gtgtgccctctagacaacagcgagtgggagttccagaagtatggtcactaa

DBGET integrated database retrieval system