Labeo rohita (rohu): 127182809 Help Entry 127182809         CDS       T09007                                  Symbol bcl2b Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism lroh  Labeo rohita (rohu) Pathway lroh04115   p53 signaling pathway lroh04140   Autophagy - animal lroh04141   Protein processing in endoplasmic reticulum lroh04210   Apoptosis lroh04217   Necroptosis lroh04261   Adrenergic signaling in cardiomyocytes lroh04340   Hedgehog signaling pathway lroh04510   Focal adhesion lroh04621   NOD-like receptor signaling pathway lroh05132   Salmonella infection lroh05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:lroh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     127182809 (bcl2b)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     127182809 (bcl2b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     127182809 (bcl2b)   09143 Cell growth and death    04210 Apoptosis     127182809 (bcl2b)    04217 Necroptosis     127182809 (bcl2b)    04115 p53 signaling pathway     127182809 (bcl2b)   09144 Cellular community - eukaryotes    04510 Focal adhesion     127182809 (bcl2b)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     127182809 (bcl2b)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     127182809 (bcl2b)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     127182809 (bcl2b)   09171 Infectious disease: bacterial    05132 Salmonella infection     127182809 (bcl2b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lroh01009]     127182809 (bcl2b) Protein phosphatases and associated proteins [BR:lroh01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      127182809 (bcl2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Cep57_MT_bd DUF4350 Motif Other DBs NCBI-GeneID:  127182809 NCBI-ProteinID:  XP_050994395 LinkDB All DBs Position 2:complement(5213370..5273380) Genome browser AA seq 210 aa AA seqDB search MAQENVYDNRSIVVKYIHHKLWKKGYVWEVNGHDDSVSNGLMMGRQEDSGVSPSSRHDPY SALHKVLREAGDELERLYQSDFAEMSKQLHLTSITAHQRFTAVIDELFRDGVNWGRIIAF FEFGGTVCVECVNKEMTAQVDNIAGWMTEYLNGPLHGWIQENGGWEAFVDLYGRQRDSVF RSSWSSIVTVFGLAALGAVGLTIGAYLAQK NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atggcacaagagaatgtctatgataaccgcagtatagtggtgaagtacatccaccataag ctctggaagaagggatacgtgtgggaagtgaacggacacgatgacagcgtctcgaatgga ctgatgatggggaggcaggaggacagcggcgtctctcccagctcccgtcacgacccgtac agcgctctccacaaggtgctacgggaggccggggacgagctggagcgcttatatcagtcg gactttgcggagatgtccaaacagctgcatctcacctccatcacggcgcatcagcgcttc accgcagtcatagatgagctgttcagggacggcgtgaactggggcagaatcatcgctttt ttcgagttcggagggacggtttgtgttgaatgcgtgaataaggagatgacggcgcaggtg gataacattgcgggatggatgaccgagtacctgaacgggccgctgcacggctggatccag gagaacggcggctgggaggcgtttgtggatctctacggcaggcagagagactcagtgttt cgcagctcgtggtcatcaatagtaaccgtcttcggtctagccgctctcggggccgttggc ttgaccataggagcctaccttgctcagaaatga

DBGET integrated database retrieval system