Lynx rufus (bobcat): 124502483 Help Entry 124502483         CDS       T08475                                  Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism lruf  Lynx rufus (bobcat) Pathway lruf04010   MAPK signaling pathway lruf04014   Ras signaling pathway lruf04015   Rap1 signaling pathway lruf04024   cAMP signaling pathway lruf04062   Chemokine signaling pathway lruf04510   Focal adhesion lruf04520   Adherens junction lruf04611   Platelet activation lruf04670   Leukocyte transendothelial migration lruf04720   Long-term potentiation lruf04722   Neurotrophin signaling pathway lruf04934   Cushing syndrome lruf04972   Pancreatic secretion lruf05211   Renal cell carcinoma lruf05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124502483    04014 Ras signaling pathway     124502483    04015 Rap1 signaling pathway     124502483    04024 cAMP signaling pathway     124502483  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     124502483    04520 Adherens junction     124502483  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     124502483    04670 Leukocyte transendothelial migration     124502483    04062 Chemokine signaling pathway     124502483   09154 Digestive system    04972 Pancreatic secretion     124502483   09156 Nervous system    04720 Long-term potentiation     124502483    04722 Neurotrophin signaling pathway     124502483  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     124502483   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124502483   09167 Endocrine and metabolic disease    04934 Cushing syndrome     124502483  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:lruf04147]     124502483    04031 GTP-binding proteins [BR:lruf04031]     124502483 Exosome [BR:lruf04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    124502483   Exosomal proteins of other body fluids (saliva and urine)    124502483   Exosomal proteins of colorectal cancer cells    124502483 GTP-binding proteins [BR:lruf04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     124502483 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  124502483 NCBI-ProteinID:  XP_046923117 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKTRKKST CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagttgttcttggctcaggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat agaaagcaagttgaagtagatgcacaacagtgtatgcttgaaatcttggatactgcagga acggaacaatttaccgcaatgagggatttatacatgaaaaacggacaaggctttgcatta gtttattccatcacagcacagtccacatttaatgatttacaagatctgagagagcaaatt cttcgagttaaagacactgatgatgttccaatgattctggttggtaataagtgtgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcaagacaatggaacaat tgtgcattcttagaatcctccgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcggcaaattaacagaaaaactccagtgcctgggaagacccgcaaaaagtcaaca tgtcagctgctttaa

DBGET integrated database retrieval system