Lynx rufus (bobcat): 124505090 Help Entry 124505090         CDS       T08475                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism lruf  Lynx rufus (bobcat) Pathway lruf00510   N-Glycan biosynthesis lruf00513   Various types of N-glycan biosynthesis lruf04141   Protein processing in endoplasmic reticulum Module lruf_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:lruf00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     124505090    00513 Various types of N-glycan biosynthesis     124505090  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124505090 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  124505090 NCBI-ProteinID:  XP_046926815 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatacaccagcccagtgaacccagctgtcttcccccat ctgaccgtggtgctgttggccattggcatgttctttaccgcctggttcttcgtctatgag gtgacctccaccaagtacactcgggatatctacaaagagctcctcatctccttggtggcc tcgcttttcatgggctttggagttctcttcctgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system