Lynx rufus (bobcat): 124519153 Help Entry 124519153         CDS       T08475                                  Name (RefSeq) actin, cytoplasmic 1   KO K05692   actin beta/gamma 1 Organism lruf  Lynx rufus (bobcat) Pathway lruf03082   ATP-dependent chromatin remodeling lruf04015   Rap1 signaling pathway lruf04145   Phagosome lruf04210   Apoptosis lruf04390   Hippo signaling pathway lruf04510   Focal adhesion lruf04520   Adherens junction lruf04530   Tight junction lruf04611   Platelet activation lruf04613   Neutrophil extracellular trap formation lruf04670   Leukocyte transendothelial migration lruf04714   Thermogenesis lruf04810   Regulation of actin cytoskeleton lruf04814   Motor proteins lruf04820   Cytoskeleton in muscle cells lruf04919   Thyroid hormone signaling pathway lruf04921   Oxytocin signaling pathway lruf04971   Gastric acid secretion lruf05014   Amyotrophic lateral sclerosis lruf05100   Bacterial invasion of epithelial cells lruf05132   Salmonella infection lruf05135   Yersinia infection lruf05164   Influenza A lruf05205   Proteoglycans in cancer lruf05225   Hepatocellular carcinoma lruf05410   Hypertrophic cardiomyopathy lruf05412   Arrhythmogenic right ventricular cardiomyopathy lruf05414   Dilated cardiomyopathy lruf05416   Viral myocarditis lruf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     124519153  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     124519153    04390 Hippo signaling pathway     124519153  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     124519153   09143 Cell growth and death    04210 Apoptosis     124519153   09144 Cellular community - eukaryotes    04510 Focal adhesion     124519153    04520 Adherens junction     124519153    04530 Tight junction     124519153   09142 Cell motility    04814 Motor proteins     124519153    04820 Cytoskeleton in muscle cells     124519153    04810 Regulation of actin cytoskeleton     124519153  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     124519153    04613 Neutrophil extracellular trap formation     124519153    04670 Leukocyte transendothelial migration     124519153   09152 Endocrine system    04921 Oxytocin signaling pathway     124519153    04919 Thyroid hormone signaling pathway     124519153   09154 Digestive system    04971 Gastric acid secretion     124519153   09159 Environmental adaptation    04714 Thermogenesis     124519153  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     124519153   09162 Cancer: specific types    05225 Hepatocellular carcinoma     124519153   09172 Infectious disease: viral    05164 Influenza A     124519153   09171 Infectious disease: bacterial    05132 Salmonella infection     124519153    05135 Yersinia infection     124519153    05100 Bacterial invasion of epithelial cells     124519153   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     124519153   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     124519153    05410 Hypertrophic cardiomyopathy     124519153    05412 Arrhythmogenic right ventricular cardiomyopathy     124519153    05414 Dilated cardiomyopathy     124519153    05416 Viral myocarditis     124519153  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:lruf03021]     124519153    03019 Messenger RNA biogenesis [BR:lruf03019]     124519153    03036 Chromosome and associated proteins [BR:lruf03036]     124519153    03029 Mitochondrial biogenesis [BR:lruf03029]     124519153   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:lruf04812]     124519153    04147 Exosome [BR:lruf04147]     124519153 Transcription machinery [BR:lruf03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      124519153 Messenger RNA biogenesis [BR:lruf03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      124519153 Chromosome and associated proteins [BR:lruf03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      124519153     NuA4 complex      124519153   Chromatin remodeling factors    BAF complex     124519153    PBAF complex     124519153    GBAF(ncBAF) complex     124519153    SWR1 complex     124519153 Mitochondrial biogenesis [BR:lruf03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     124519153 Cytoskeleton proteins [BR:lruf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      124519153 Exosome [BR:lruf04147]  Exosomal proteins   Proteins found in most exosomes    124519153 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  124519153 NCBI-ProteinID:  XP_046945152 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgatgatattgctgcgctcgtggtcgacaacggctccggcatgtgcaaggccggc ttcgcaggcgacgatgccccacgggccgtcttcccttccatcgtggggcgcccccggcac cagggcgtgatggtgggtatgggccagaaggactcctacgtgggcgatgaggcccagagc aagaggggcatcctgaccctgaagtaccccatcgagcacggtattgtcaccaactgggac gacatggagaagatctggcatcacactttctacaatgagctgcgtgtggcccccgaggag cacccagtgctgctgaccgaggcccccctgaaccccaaggccaaccgtgagaagatgacc cagatcatgttcgagaccttcaacaccccggccatgtacgtggccatccaggccgtgctg tccctgtacgcctctggccgcaccaccggcatcgtgatggactccggggacggggtcacc cacactgtgcccatctacgaggggtatgccctgccccacgccatcctgcgtctggacctg gctggccgggacctgacggactacctcatgaagatcctcacggagcgcggctacagcttc accaccaccgccgagcgggaaattgtgcgtgacatcaaggagaagctctgctacgtggcc ttggacttcgagcaggagatggccaccgccgcgtcctcgtcctccctggagaagagctac gagctgcccgacgggcaggtgatcaccatcggcaacgagcggttccgctgccctgaggcg ctcttccagccttccttcctgggcatggaatcctgtggtatccacgaaactaccttcaac tccatcatgaagtgcgacgtcgacatccgcaaggacctctacgccaacacggtgctgtct ggggggaccaccatgtaccccggcatcgctgaccggatgcagaaggagatcaccgccctg gcgcccagcacgatgaagatcaagatcatcgcaccccccgagcgcaagtactccgtgtgg atcggcggctccatcctggcgtcgctgtccaccttccagcagatgtggatcagcaagcag gagtacgacgagtccggcccctccatcgtccaccgcaaatgcttctag

DBGET integrated database retrieval system