Lynx rufus (bobcat): 124528979 Help Entry 124528979         CDS       T08475                                  Name (RefSeq) tumor necrosis factor   KO K03156   tumor necrosis factor superfamily, member 2 Organism lruf  Lynx rufus (bobcat) Pathway lruf01523   Antifolate resistance lruf04010   MAPK signaling pathway lruf04060   Cytokine-cytokine receptor interaction lruf04061   Viral protein interaction with cytokine and cytokine receptor lruf04064   NF-kappa B signaling pathway lruf04071   Sphingolipid signaling pathway lruf04150   mTOR signaling pathway lruf04210   Apoptosis lruf04217   Necroptosis lruf04350   TGF-beta signaling pathway lruf04380   Osteoclast differentiation lruf04612   Antigen processing and presentation lruf04620   Toll-like receptor signaling pathway lruf04621   NOD-like receptor signaling pathway lruf04622   RIG-I-like receptor signaling pathway lruf04625   C-type lectin receptor signaling pathway lruf04640   Hematopoietic cell lineage lruf04650   Natural killer cell mediated cytotoxicity lruf04657   IL-17 signaling pathway lruf04660   T cell receptor signaling pathway lruf04664   Fc epsilon RI signaling pathway lruf04668   TNF signaling pathway lruf04920   Adipocytokine signaling pathway lruf04930   Type II diabetes mellitus lruf04931   Insulin resistance lruf04932   Non-alcoholic fatty liver disease lruf04933   AGE-RAGE signaling pathway in diabetic complications lruf04936   Alcoholic liver disease lruf04940   Type I diabetes mellitus lruf05010   Alzheimer disease lruf05014   Amyotrophic lateral sclerosis lruf05020   Prion disease lruf05022   Pathways of neurodegeneration - multiple diseases lruf05132   Salmonella infection lruf05133   Pertussis lruf05134   Legionellosis lruf05135   Yersinia infection lruf05140   Leishmaniasis lruf05142   Chagas disease lruf05143   African trypanosomiasis lruf05144   Malaria lruf05145   Toxoplasmosis lruf05146   Amoebiasis lruf05152   Tuberculosis lruf05160   Hepatitis C lruf05161   Hepatitis B lruf05163   Human cytomegalovirus infection lruf05164   Influenza A lruf05165   Human papillomavirus infection lruf05166   Human T-cell leukemia virus 1 infection lruf05168   Herpes simplex virus 1 infection lruf05169   Epstein-Barr virus infection lruf05170   Human immunodeficiency virus 1 infection lruf05171   Coronavirus disease - COVID-19 lruf05205   Proteoglycans in cancer lruf05310   Asthma lruf05321   Inflammatory bowel disease lruf05322   Systemic lupus erythematosus lruf05323   Rheumatoid arthritis lruf05330   Allograft rejection lruf05332   Graft-versus-host disease lruf05410   Hypertrophic cardiomyopathy lruf05414   Dilated cardiomyopathy lruf05417   Lipid and atherosclerosis lruf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:lruf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124528979    04350 TGF-beta signaling pathway     124528979    04064 NF-kappa B signaling pathway     124528979    04668 TNF signaling pathway     124528979    04071 Sphingolipid signaling pathway     124528979    04150 mTOR signaling pathway     124528979   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     124528979    04061 Viral protein interaction with cytokine and cytokine receptor     124528979  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     124528979    04217 Necroptosis     124528979  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     124528979    04620 Toll-like receptor signaling pathway     124528979    04621 NOD-like receptor signaling pathway     124528979    04622 RIG-I-like receptor signaling pathway     124528979    04625 C-type lectin receptor signaling pathway     124528979    04650 Natural killer cell mediated cytotoxicity     124528979    04612 Antigen processing and presentation     124528979    04660 T cell receptor signaling pathway     124528979    04657 IL-17 signaling pathway     124528979    04664 Fc epsilon RI signaling pathway     124528979   09152 Endocrine system    04920 Adipocytokine signaling pathway     124528979   09158 Development and regeneration    04380 Osteoclast differentiation     124528979  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     124528979   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     124528979    05170 Human immunodeficiency virus 1 infection     124528979    05161 Hepatitis B     124528979    05160 Hepatitis C     124528979    05171 Coronavirus disease - COVID-19     124528979    05164 Influenza A     124528979    05168 Herpes simplex virus 1 infection     124528979    05163 Human cytomegalovirus infection     124528979    05169 Epstein-Barr virus infection     124528979    05165 Human papillomavirus infection     124528979   09171 Infectious disease: bacterial    05132 Salmonella infection     124528979    05135 Yersinia infection     124528979    05133 Pertussis     124528979    05134 Legionellosis     124528979    05152 Tuberculosis     124528979   09174 Infectious disease: parasitic    05146 Amoebiasis     124528979    05144 Malaria     124528979    05145 Toxoplasmosis     124528979    05140 Leishmaniasis     124528979    05142 Chagas disease     124528979    05143 African trypanosomiasis     124528979   09163 Immune disease    05310 Asthma     124528979    05322 Systemic lupus erythematosus     124528979    05323 Rheumatoid arthritis     124528979    05321 Inflammatory bowel disease     124528979    05330 Allograft rejection     124528979    05332 Graft-versus-host disease     124528979   09164 Neurodegenerative disease    05010 Alzheimer disease     124528979    05014 Amyotrophic lateral sclerosis     124528979    05020 Prion disease     124528979    05022 Pathways of neurodegeneration - multiple diseases     124528979   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     124528979    05418 Fluid shear stress and atherosclerosis     124528979    05410 Hypertrophic cardiomyopathy     124528979    05414 Dilated cardiomyopathy     124528979   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     124528979    04940 Type I diabetes mellitus     124528979    04936 Alcoholic liver disease     124528979    04932 Non-alcoholic fatty liver disease     124528979    04931 Insulin resistance     124528979    04933 AGE-RAGE signaling pathway in diabetic complications     124528979   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     124528979  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lruf04052]     124528979    00536 Glycosaminoglycan binding proteins [BR:lruf00536]     124528979 Cytokines and neuropeptides [BR:lruf04052]  Cytokines   Tumor necrosis fators    124528979 Glycosaminoglycan binding proteins [BR:lruf00536]  Heparan sulfate / Heparin   Cytokines    124528979 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  124528979 NCBI-ProteinID:  XP_046958821 LinkDB All DBs Position Unknown AA seq 306 aa AA seqDB search MQLSAHPVSRSFLSEDTRGPARRETEATPDPPGNNISDDTPPDKQPGDSLPLTHAALGLY HHPAGLESPGKNAMSTESMIRDVELAEEALPKKAGGPQGSRRCLCLSLFSFLLVAGATTL FCLLHFGVIGPQREELPHGLQLINPLPQTLRSSSRTPSDKPVAHVVANPEAEGQLQWLSR RANALLANGVELTDNQLKVPSDGLYLIYSQVLFTGQGCPSTHVLLTHTISRFAVSYQTKV NLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINLPNYLDFAESGQVY FGIIAL NT seq 921 nt NT seq  +upstreamnt  +downstreamnt atgcagctgtctgcacacccagtcagcagaagcttcctcagcgaagacaccaggggacca gccaggagagagacagaagcaactccagacccccccggaaataacatctcagacgacaca cccccagacaagcagccaggcgattctctccctctcacacacgctgccttagggctctac catcacccagctggacttgagtcccctgggaagaacgccatgagcactgaaagcatgatc cgggacgtggagctggccgaggaggcactccccaagaaggcagggggcccccagggctcc agaaggtgcttgtgcctcagcctcttctccttcctcctcgtcgcaggagccaccacactc ttctgcctgctgcactttggagtgatcggcccccagagggaagagctcccacatggcctg caactaatcaaccctctgccccagacactcagatcatcttctcgaactccgagtgacaag ccagtagcccatgtagtagcaaaccccgaagctgaagggcaactccagtggctgagccgg cgtgccaatgccctcctggccaatggtgtggagctgacagacaaccagctgaaggtgccc tcagacgggctgtacctcatctactcccaggtcctcttcacgggccaaggatgtccttcc acacatgtgctcctcacccacaccatcagccgctttgccgtttcctaccagaccaaggtc aacctcctctctgccatcaagagcccttgccagagggagaccccagagggggctgaggcc aagccctggtatgagcccatctacctgggaggggtcttccaactggagaagggtgatcga ctcagcgctgagatcaatctgcctaactatcttgactttgccgagtctgggcaagtctac tttggaatcattgccctgtga

DBGET integrated database retrieval system