Leptidea sinapis (Wood White): 126974392 Help Entry 126974392         CDS       T09272                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism lsin  Leptidea sinapis (Wood White) Pathway lsin00510   N-Glycan biosynthesis lsin00513   Various types of N-glycan biosynthesis lsin04141   Protein processing in endoplasmic reticulum Module lsin_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:lsin00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     126974392    00513 Various types of N-glycan biosynthesis     126974392  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     126974392 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 CAAD Pox_E2-like Motif Other DBs NCBI-GeneID:  126974392 NCBI-ProteinID:  XP_050677827 LinkDB All DBs Position 32:complement(1649263..1649821) Genome browser AA seq 81 aa AA seqDB search MSLEIESMVRHVSPINPAVFPHLTLLLLSIGIFFTAWFFVYEVTSTKSSRDLFKELLLSL VASLFSGFGILFLLLWVGIYV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgagtttggagatcgagtcaatggtacgtcatgtatcaccgataaatcccgcggtattt cctcatcttactctgctgttactgagcattgggatattttttaccgcgtggttcttcgta tatgaagtcacaagtactaaatcatcaagagatttgtttaaagaactgttgttgtcactg gttgcatcattgttctctggatttggtatactatttcttttgttatgggtaggaatctat gtatga

DBGET integrated database retrieval system