Lonchura striata (white-rumped munia): 110483089 Help Entry 110483089         CDS       T05897                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lsr  Lonchura striata (white-rumped munia) Pathway lsr03420   Nucleotide excision repair lsr04110   Cell cycle lsr04114   Oocyte meiosis lsr04120   Ubiquitin mediated proteolysis lsr04141   Protein processing in endoplasmic reticulum lsr04310   Wnt signaling pathway lsr04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:lsr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110483089 (RBX1)    04120 Ubiquitin mediated proteolysis     110483089 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     110483089 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     110483089 (RBX1)    04350 TGF-beta signaling pathway     110483089 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     110483089 (RBX1)    04114 Oocyte meiosis     110483089 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lsr04121]     110483089 (RBX1)    03400 DNA repair and recombination proteins [BR:lsr03400]     110483089 (RBX1) Enzymes [BR:lsr01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110483089 (RBX1) Ubiquitin system [BR:lsr04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110483089 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      110483089 (RBX1)    Cul2 complex      110483089 (RBX1)    Cul3 complex      110483089 (RBX1)    Cul4 complex      110483089 (RBX1)    Cul7 complex      110483089 (RBX1)    Cul8 complex      110483089 (RBX1)    Cul9 complex      110483089 (RBX1) DNA repair and recombination proteins [BR:lsr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110483089 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       110483089 (RBX1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  110483089 NCBI-ProteinID:  XP_021408413 LinkDB All DBs Position 1A:15532133..15542991 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcaatggatgtggacactcccagcggaaccaacagcggcgccggcaagaag cgcttcgaagtgaagaaatggaacgccgtagctctgtgggcatgggacattgtggttgat aactgtgccatttgcagaaaccacattatggatctgtgcatagaatgtcaagccaaccaa gcatcggctacctctgaagaatgcacagttgcatggggcgtctgcaatcatgctttccac ttccactgcatctctcgctggctcaaaacacgccaagtatgtccactggacaacagggaa tgggagttccaaaagtatggacactag

DBGET integrated database retrieval system