Lactuca sativa (garden lettuce): 111882147 Help Entry 111882147         CDS       T05352                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lsv  Lactuca sativa (garden lettuce) Pathway lsv03420   Nucleotide excision repair lsv04120   Ubiquitin mediated proteolysis lsv04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lsv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111882147    04120 Ubiquitin mediated proteolysis     111882147   09124 Replication and repair    03420 Nucleotide excision repair     111882147  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lsv04121]     111882147    03400 DNA repair and recombination proteins [BR:lsv03400]     111882147 Enzymes [BR:lsv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111882147 Ubiquitin system [BR:lsv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111882147   Multi subunit type E3    SCF complex     Ring finger protein      111882147    Cul2 complex      111882147    Cul3 complex      111882147    Cul4 complex      111882147    Cul7 complex      111882147    Cul8 complex      111882147    Cul9 complex      111882147 DNA repair and recombination proteins [BR:lsv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111882147     TCR (transcription coupled repair) factors      Cul4-CSA complex       111882147 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  111882147 NCBI-ProteinID:  XP_023734279 LinkDB All DBs Position 1:complement(46051808..46053234) Genome browser AA seq 115 aa AA seqDB search MDSDVTMVPAGEGSSFPGPSSSSKKPKRFEIKKWNAVSLWAWDIVVDNCAICRNHIMDLC IECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKYGH NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atggactccgacgtgacgatggtacccgccggtgaaggatctagttttccaggaccttct tcctcttcaaagaaaccaaagcgtttcgaaatcaagaagtggaatgccgtctctctctgg gcttgggatattgtggttgataattgcgcgatctgcagaaatcacatcatggatctgtgt atcgaatgccaagctaatcaggcaagcgccaccagcgaggagtgtactgttgcttggggt gtctgcaaccatgcttttcactttcactgcattagccgctggctcaagactcgtcaagtg tgccctcttgacaacagtgagtgggagttccagaaatatggtcattag

DBGET integrated database retrieval system