KEGG   Lactuca sativa (garden lettuce): 111890493
Entry
111890493         CDS       T05352                                 
Name
(RefSeq) costunolide synthase-like
  KO
K20561  costunolide synthase [EC:1.14.14.150]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00909  Sesquiterpenoid and triterpenoid biosynthesis
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111890493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lsv00199]
    111890493
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.150  costunolide synthase
     111890493
Cytochrome P450 [BR:lsv00199]
 Cytochrome P450, plant type
  CYP71 family
   111890493
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111890493
NCBI-ProteinID: XP_023742371
LinkDB
Position
7:46434750..46436600
AA seq 493 aa
MEPLTIVSLAVASFLLFAFWALSPKTSKNLPPGPPKLPIIGNIHQLKSPTPHRVLRNLAK
KYGPIMHLQLGQVSTVVVSTPRLAREIMKTNDISFADRPTTTTSQIFFYKAQDIGWAPYG
EYWRQMKKICTLELLSAKKVRSFSSIREEELRRISKVLESKAGTPVNFTEMTVEMVNNVI
CKATLGDSCKDQATLIEVLYDVLKTLSAFNLASYYPGLQFLNVILGKKAKWLKMQKQLDD
ILEDVLKEHRSKGRNKSDQEDLVDVLLRVKETGGLDFTVTDEHVKAVVLDMLTAGTDTSS
ATLEWAMTELMRNPDMMKRAQEEVRSVVKGDTITETDLQSLHYLKLIVKETLRLHAPTPL
LVPRECRQACNVDGYDIPAKTKILVNAWACGTDPDSWKDAESFIPERFENCPINYMGADF
EFIPFGAGRRICPGLTFGLSMVEYPLANFLYHFDWKLPNGLKPHELDITEITGISTSLKH
QLKIVPVPRSLAH
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggagcctctcaccatcgtctccctcgctgtggcttcattccttctctttgctttttgg
gcattatcaccgaagacctccaagaacttgccaccaggtccaccaaaactacccatcatc
ggaaacatacaccaactcaaaagcccaactcctcatcgagttcttagaaacttagccaag
aaatatggccccatcatgcatctacagctcggacaagtctctacagtcgtcgtgtctaca
cctcgacttgctcgagagatcatgaaaaccaacgatatcagctttgctgacagacccacc
accacaacctcccaaatcttcttttataaagctcaagacattgggtgggctccatatggc
gaatactggaggcagatgaagaagatttgcaccttggagcttcttagtgctaaaaaagtt
cgatcttttagctctattcgggaagaggaacttagacgtatcagtaaggttcttgaatcg
aaagccggaacacccgtcaacttcactgaaatgactgtggagatggtgaataatgtcatc
tgcaaggctacgttaggagattcctgcaaagaccaggctactttgatcgaggtgttgtat
gatgtgttgaaaactttgagtgctttcaatctagcatcgtattatcctggtctacagttt
cttaatgtgatcttggggaagaaagccaagtggttgaagatgcagaagcagcttgatgac
atcttggaagatgtgttaaaggaacacagatctaaaggaagaaacaagagcgatcaggaa
gatctagttgatgttcttttgagagtcaaagaaaccggtggcttggatttcacagtcaca
gatgaacatgtcaaagccgttgttctggatatgttaactgctggaacagatacatcttca
gcaacacttgaatgggcgatgactgagctcatgaggaaccctgacatgatgaagagagca
caagaagaagtgagatcggtggtgaaaggagacacaatcaccgaaacggatttacaaagc
ttgcattacctgaaactaatagtaaaggaaacactgaggttacatgctcctacaccttta
ttagtacccagagaatgccgacaagcttgcaacgtcgacggatatgatattccggcaaag
actaagatccttgtaaacgcctgggcttgtggaacagaccctgacagttggaaagatgcc
gaaagcttcatcccggagagatttgagaactgtccgatcaattacatgggtgcagatttc
gagttcattccgttcggtgctggccggagaatttgccccggacttacatttgggttgagt
atggttgaatacccacttgctaatttcttgtatcattttgattggaaacttccaaatgga
ttgaaaccccatgagcttgacatcacggaaatcacagggatttccacatcgcttaaacat
cagttgaaaatcgtaccggtccccaggtccttagcacattga

DBGET integrated database retrieval system