KEGG   Lactuca sativa (garden lettuce): 111890503
Entry
111890503         CDS       T05352                                 
Name
(RefSeq) costunolide synthase
  KO
K20561  costunolide synthase [EC:1.14.14.150]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00909  Sesquiterpenoid and triterpenoid biosynthesis
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    111890503
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:lsv00199]
    111890503
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.150  costunolide synthase
     111890503
Cytochrome P450 [BR:lsv00199]
 Cytochrome P450, plant type
  CYP71 family
   111890503
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 111890503
NCBI-ProteinID: XP_023742381
LinkDB
Position
7:complement(46256834..46258597)
AA seq 490 aa
MEPLTIVSLAVASFLLFAFWALSPKTSKNLPPGPPKLPIIGNIHQLKSPTPHRVLRNLAK
KYGPIMHLQLGQVSTVVVSTPRLAREIMKTNDISFADRPTTTTSQIFFYKAQDIGWAPYG
EYWRQMKKICTLELLSAKKVRSFSSIREEELRRISKVLESKAGTPVNFTEMTVEMVNNVI
CKATLGDSCKDQATLIEVLYDVLKTLSAFNLASYYPGLQFLNVILGKKAKWLKMQKQLDD
ILEDVLKEHRSKGRNKSDQEDLVDVLLRVKDTGGLDFTVTDEHVKAVVLDMLTAGTDTSS
ATLEWAMTELMRNPHMMKRAQEEVRSVVKGDTITETDLQSLHYLKLIVKETLRLHAPTPL
LVPRECRQACNVDGYDIPAKTKILVNAWACGTDPDSWKDAESFIPERFENCPINYMGADF
EFIPFGAGRRICPGLTFGLSMVEYPLANFLYHFDWKLPNGLKPHELDITEITGISTSLKH
QLKIVPILKS
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaacctctcaccatcgtctccctcgctgtggcttcattccttctctttgctttttgg
gcattatcaccgaagacctccaagaacttgccaccaggtccaccaaaactacccatcatc
ggaaacatacaccaactcaaaagcccaactcctcatcgagttcttagaaacttagccaag
aaatatggccccatcatgcatctacagctcggacaagtctctacagtcgtcgtgtctaca
cctcgacttgctcgagagatcatgaaaaccaacgatatcagctttgctgacagacccacc
accacaacctcccaaatcttcttctataaagctcaagacattgggtgggctccttatggc
gaatactggaggcagatgaagaagatttgcaccttggagcttcttagtgccaaaaaagtt
cgatcttttagctctattcgagaagaggagcttagacgtatcagtaaggttcttgaatcg
aaagccggaacacccgtcaacttcacggaaatgactgtggagatggtgaataatgtcatc
tgcaaggctacgttaggagattcctgcaaagaccaggctactttgatcgaggttttgtat
gatgtgttgaaaactttgagtgctttcaatctagcatcgtattatcctggtctacagttt
cttaatgtgatcttggggaagaaagccaagtggttgaagatgcagaaacagcttgatgac
atcttggaagatgtattaaaggaacacagatctaaaggaagaaacaagagcgatcaggaa
gatcttgttgatgttcttttgagagtcaaagacaccggtggactggatttcacagtcaca
gacgaacatgtcaaagccgttgttctggatatgttaactgctggaacagatacatcttca
gcaacacttgaatgggcgatgactgagctcatgaggaaccctcacatgatgaagagagca
caagaagaagtgagatcggtggtgaaaggagacacaatcaccgaaacggatttacaaagc
ttgcattacctgaaactaatagtaaaggaaacactgaggttacatgctcctacaccttta
ttagtacccagagaatgccgacaagcttgcaacgtcgatggatatgatattccggcaaag
actaagatccttgtaaacgcctgggcttgtggaacagaccctgacagttggaaagatgca
gaaagcttcatcccggagagatttgagaactgtccgatcaattacatgggtgcagatttc
gagttcattccgtttggtgctggccggagaatttgccccggacttacatttgggttgagt
atggttgaatacccacttgctaatttcttgtatcattttgattggaaacttccaaatgga
ttgaaaccccatgagcttgacatcacggaaatcacagggatttctacatcgctcaaacat
cagttgaaaatcgtcccgatcctcaagtcctag

DBGET integrated database retrieval system