Lactuca sativa (garden lettuce): 111892622 Help Entry 111892622         CDS       T05352                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lsv  Lactuca sativa (garden lettuce) Pathway lsv03420   Nucleotide excision repair lsv04120   Ubiquitin mediated proteolysis lsv04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lsv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111892622    04120 Ubiquitin mediated proteolysis     111892622   09124 Replication and repair    03420 Nucleotide excision repair     111892622  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lsv04121]     111892622    03400 DNA repair and recombination proteins [BR:lsv03400]     111892622 Enzymes [BR:lsv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111892622 Ubiquitin system [BR:lsv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111892622   Multi subunit type E3    SCF complex     Ring finger protein      111892622    Cul2 complex      111892622    Cul3 complex      111892622    Cul4 complex      111892622    Cul7 complex      111892622    Cul8 complex      111892622    Cul9 complex      111892622 DNA repair and recombination proteins [BR:lsv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111892622     TCR (transcription coupled repair) factors      Cul4-CSA complex       111892622 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  111892622 NCBI-ProteinID:  XP_023744443 LinkDB All DBs Position 5:complement(297568095..297571371) Genome browser AA seq 125 aa AA seqDB search MASLDTDVTMVPAGEGSGGAGPSSSTASTSSSTKKAKRFEIKKWNAVSLWAWDIVVDNCA ICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEF QKYGH NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggcttctctagacaccgatgtcaccatggttccggctggcgagggttcaggcggagcc ggaccttcttcttcaaccgcctccacttcttcgtcaaccaagaaagctaagcgatttgag atcaaaaagtggaacgctgtttctctatgggcttgggatatcgtcgtggataattgcgcg atatgtaggaatcatatcatggatctctgcattgaatgtcaggctaatcaagccagtgct accagtgaggaatgcacagttgcttggggtgtctgcaatcatgccttccactttcactgt attagcagatggctcaaaactcgtcaagtctgcccattagataacagtgaatgggaattc cagaagtatggtcattag

DBGET integrated database retrieval system