Lactuca sativa (garden lettuce): 111902717 Help Entry 111902717         CDS       T05352                                  Name (RefSeq) RING-box protein 1a   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lsv  Lactuca sativa (garden lettuce) Pathway lsv03420   Nucleotide excision repair lsv04120   Ubiquitin mediated proteolysis lsv04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:lsv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     111902717    04120 Ubiquitin mediated proteolysis     111902717   09124 Replication and repair    03420 Nucleotide excision repair     111902717  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lsv04121]     111902717    03400 DNA repair and recombination proteins [BR:lsv03400]     111902717 Enzymes [BR:lsv01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      111902717 Ubiquitin system [BR:lsv04121]  Ubiquitin ligases (E3)   UBL E3 ligases    111902717   Multi subunit type E3    SCF complex     Ring finger protein      111902717    Cul2 complex      111902717    Cul3 complex      111902717    Cul4 complex      111902717    Cul7 complex      111902717    Cul8 complex      111902717    Cul9 complex      111902717 DNA repair and recombination proteins [BR:lsv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       111902717     TCR (transcription coupled repair) factors      Cul4-CSA complex       111902717 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  111902717 NCBI-ProteinID:  XP_023754299 LinkDB All DBs Position 4:163546604..163548243 Genome browser AA seq 122 aa AA seqDB search MDSDVTMVPASDASSLPGPSSSSAVASSSSKKPKRFEIKKWNAVALWAWDIVVDNCAICR NHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNSEWEFQKY GH NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggattccgacgtgacgatggttccggccagtgacgcatctagtcttccaggaccttct tcatcttcagccgtggcctcttcttcttcgaagaaacccaagcgttttgaaatcaagaag tggaacgctgtcgcactttgggcttgggatatcgtggttgacaattgcgcgatctgtaga aaccacatcatggatctatgtatcgagtgccaagctaatcaggccagcgctactagcgag gagtgtactgtggcttggggtgtatgtaaccatgctttccatttccactgcattagccgc tggctaaaaacacgtcaagtttgccctcttgataatagcgagtgggagttccagaaatac ggtcactag

DBGET integrated database retrieval system