Leptonychotes weddellii (Weddell seal): 102725545 Help Entry 102725545         CDS       T08708                                  Name (RefSeq) caspase-9-like   KO K04399   caspase 9 [EC:3.4.22.62] Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww01524   Platinum drug resistance lww04115   p53 signaling pathway lww04151   PI3K-Akt signaling pathway lww04210   Apoptosis lww04215   Apoptosis - multiple species lww04370   VEGF signaling pathway lww04919   Thyroid hormone signaling pathway lww05010   Alzheimer disease lww05012   Parkinson disease lww05014   Amyotrophic lateral sclerosis lww05016   Huntington disease lww05020   Prion disease lww05022   Pathways of neurodegeneration - multiple diseases lww05134   Legionellosis lww05145   Toxoplasmosis lww05152   Tuberculosis lww05160   Hepatitis C lww05161   Hepatitis B lww05162   Measles lww05163   Human cytomegalovirus infection lww05164   Influenza A lww05167   Kaposi sarcoma-associated herpesvirus infection lww05168   Herpes simplex virus 1 infection lww05169   Epstein-Barr virus infection lww05170   Human immunodeficiency virus 1 infection lww05200   Pathways in cancer lww05210   Colorectal cancer lww05212   Pancreatic cancer lww05213   Endometrial cancer lww05215   Prostate cancer lww05222   Small cell lung cancer lww05223   Non-small cell lung cancer lww05416   Viral myocarditis lww05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04370 VEGF signaling pathway     102725545    04151 PI3K-Akt signaling pathway     102725545  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     102725545    04215 Apoptosis - multiple species     102725545    04115 p53 signaling pathway     102725545  09150 Organismal Systems   09152 Endocrine system    04919 Thyroid hormone signaling pathway     102725545  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102725545   09162 Cancer: specific types    05210 Colorectal cancer     102725545    05212 Pancreatic cancer     102725545    05215 Prostate cancer     102725545    05213 Endometrial cancer     102725545    05222 Small cell lung cancer     102725545    05223 Non-small cell lung cancer     102725545   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102725545    05161 Hepatitis B     102725545    05160 Hepatitis C     102725545    05164 Influenza A     102725545    05162 Measles     102725545    05168 Herpes simplex virus 1 infection     102725545    05163 Human cytomegalovirus infection     102725545    05167 Kaposi sarcoma-associated herpesvirus infection     102725545    05169 Epstein-Barr virus infection     102725545   09171 Infectious disease: bacterial    05134 Legionellosis     102725545    05152 Tuberculosis     102725545   09174 Infectious disease: parasitic    05145 Toxoplasmosis     102725545   09164 Neurodegenerative disease    05010 Alzheimer disease     102725545    05012 Parkinson disease     102725545    05014 Amyotrophic lateral sclerosis     102725545    05016 Huntington disease     102725545    05020 Prion disease     102725545    05022 Pathways of neurodegeneration - multiple diseases     102725545   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102725545    05416 Viral myocarditis     102725545   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     102725545  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:lww01009]     102725545    01002 Peptidases and inhibitors [BR:lww01002]     102725545 Enzymes [BR:lww01000]  3. Hydrolases   3.4  Acting on peptide bonds (peptidases)    3.4.22  Cysteine endopeptidases     3.4.22.62  caspase-9      102725545 Protein phosphatases and associated proteins [BR:lww01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      102725545 Peptidases and inhibitors [BR:lww01002]  Cysteine peptidases   Family C14: caspase family    102725545 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_C14 Motif Other DBs NCBI-GeneID:  102725545 NCBI-ProteinID:  XP_006745761 UniProt:  A0A2U3YPV6 LinkDB All DBs Position Unknown AA seq 278 aa AA seqDB search MSRAQEISKQNPDLAYALNADPCGHCLIINNVNFCLESRLTARTGSDIDCEKLQRRFRLL HFTVEVKCDLMAKQMVQALVELARRDHSGLDCCVVVVLSHGCQASHRQFPGAVYGTDGCL VSIEKIVNIFNGASCPSLGGKPKLFFIQACGGEQKDHGFEVACASPEDRTSGSDPESDAV LFQEGPGPFDQPDAVSSLPTPSDIFVSYSTFPGFVSWRDTRRGSWYVETLDGVFEQWAHS EDLQTLLLRVANAVSQKGIYKQIPGCFNFLRKKLFFKM NT seq 837 nt NT seq  +upstreamnt  +downstreamnt atgtcacgtgctcaggagatttccaagcaaaatcctgatttggcctacgccctgaacgca gacccctgtggccactgcctcatcatcaacaacgtgaacttctgcctcgagtcaaggctc acggcccgcaccggctccgatatcgactgtgaaaagctgcagcgacgcttccgcttgctg catttcacggtggaggtgaagtgcgacctgatggccaagcaaatggtccaggctttggtg gagctggcgcggcgggaccacagcggcctggactgctgcgtggtggttgtcctctctcac ggctgtcaggccagccaccgccagttcccaggggcggtttatggcacggatggatgtctt gtgtccatcgagaaaattgtgaacatcttcaatggagccagctgccccagcttgggaggg aagcccaagctcttcttcatccaggcctgtggtggggagcagaaagaccatgggtttgag gtggcctgcgcttcccctgaagacaggacctctggcagtgacccggagtcagacgctgtc ctgttccaggaaggcccaggcccctttgaccagccagacgccgtgtctagtttgcccaca cccagtgatatcttcgtgtcctactccaccttcccaggctttgtttcctggagggatacc aggagaggctcctggtacgtggagaccttggatggggtttttgagcagtgggctcactct gaagacctgcagaccctcctgctcagggtcgctaatgctgtttcgcagaaagggatttac aaacagattcccggttgtttcaatttcctccggaaaaaactcttttttaaaatgtga

DBGET integrated database retrieval system