Leptonychotes weddellii (Weddell seal): 102748318 Help Entry 102748318         CDS       T08708                                  Symbol RBX1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww03420   Nucleotide excision repair lww04066   HIF-1 signaling pathway lww04110   Cell cycle lww04114   Oocyte meiosis lww04120   Ubiquitin mediated proteolysis lww04141   Protein processing in endoplasmic reticulum lww04310   Wnt signaling pathway lww04350   TGF-beta signaling pathway lww04710   Circadian rhythm lww05170   Human immunodeficiency virus 1 infection lww05200   Pathways in cancer lww05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:lww00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     102748318 (RBX1)    04120 Ubiquitin mediated proteolysis     102748318 (RBX1)   09124 Replication and repair    03420 Nucleotide excision repair     102748318 (RBX1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     102748318 (RBX1)    04350 TGF-beta signaling pathway     102748318 (RBX1)    04066 HIF-1 signaling pathway     102748318 (RBX1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     102748318 (RBX1)    04114 Oocyte meiosis     102748318 (RBX1)  09150 Organismal Systems   09159 Environmental adaptation    04710 Circadian rhythm     102748318 (RBX1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102748318 (RBX1)   09162 Cancer: specific types    05211 Renal cell carcinoma     102748318 (RBX1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102748318 (RBX1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:lww04121]     102748318 (RBX1)    03400 DNA repair and recombination proteins [BR:lww03400]     102748318 (RBX1) Enzymes [BR:lww01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      102748318 (RBX1) Ubiquitin system [BR:lww04121]  Ubiquitin ligases (E3)   UBL E3 ligases    102748318 (RBX1)   Multi subunit type E3    SCF complex     Ring finger protein      102748318 (RBX1)    Cul2 complex      102748318 (RBX1)    Cul3 complex      102748318 (RBX1)    Cul4 complex      102748318 (RBX1)    Cul7 complex      102748318 (RBX1)    Cul8 complex      102748318 (RBX1)    Cul9 complex      102748318 (RBX1) DNA repair and recombination proteins [BR:lww03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       102748318 (RBX1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       102748318 (RBX1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  102748318 NCBI-ProteinID:  XP_006729981 UniProt:  A0A2U3XEU7 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgtggataccccgagcggcaccaacagcggcgcgggcaagaag cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat aactgtgccatctgcaggaaccacattatggatctttgcatagaatgtcaagctaaccag gcgtctgctacttctgaagagtgcactgttgcatggggagtctgtaaccatgcttttcac ttccactgcatctctcgctggctcaaaacacggcaggtgtgtccgttggacaacagagag tgggaattccaaaagtatgggcactag

DBGET integrated database retrieval system