Leptonychotes weddellii (Weddell seal): 102748346 Help Entry 102748346         CDS       T08708                                  Symbol POMC Name (RefSeq) pro-opiomelanocortin   KO K05228   proopiomelanocortin Organism lww  Leptonychotes weddellii (Weddell seal) Pathway lww04024   cAMP signaling pathway lww04080   Neuroactive ligand-receptor interaction lww04081   Hormone signaling lww04082   Neuroactive ligand signaling lww04915   Estrogen signaling pathway lww04916   Melanogenesis lww04920   Adipocytokine signaling pathway lww04925   Aldosterone synthesis and secretion lww04927   Cortisol synthesis and secretion lww04934   Cushing syndrome Brite KEGG Orthology (KO) [BR:lww00001]  09130 Environmental Information Processing   09132 Signal transduction    04024 cAMP signaling pathway     102748346 (POMC)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102748346 (POMC)    04082 Neuroactive ligand signaling     102748346 (POMC)    04081 Hormone signaling     102748346 (POMC)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     102748346 (POMC)    04915 Estrogen signaling pathway     102748346 (POMC)    04916 Melanogenesis     102748346 (POMC)    04925 Aldosterone synthesis and secretion     102748346 (POMC)    04927 Cortisol synthesis and secretion     102748346 (POMC)  09160 Human Diseases   09167 Endocrine and metabolic disease    04934 Cushing syndrome     102748346 (POMC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:lww04052]     102748346 (POMC) Cytokines and neuropeptides [BR:lww04052]  Neuropeptides   GPCR binding    102748346 (POMC) SSDB OrthologParalogGFIT Motif Pfam:  ACTH_domain Op_neuropeptide Motif Other DBs NCBI-GeneID:  102748346 NCBI-ProteinID:  XP_006732938 UniProt:  A0A2U3XNM4 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKRELAGGRPEPALGPEGPAGGVAA LADLEYGLLTEAEVAEKKDGGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAI IKNAHKKGQ NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggagcacttccgctggggcaagcctgtgggcaagaagcggcgcccggtgaaggtgtac cccaacggcgccgaggacgagtcggccgaggccttcccgctcgagttcaagagggagctg gccggggggcggcctgagccggcgctcggccccgagggcccggccgggggcgtggcggcc ctggccgacctggagtacggcctgctgaccgaggccgaggtggccgagaagaaggacggc gggccctataagatggagcacttccgctggggcagcccgcccaaggacaagcgctacggc ggcttcatgacctccgagaagagccagacccccctggtgacgctcttcaaaaacgccatc atcaagaacgcccacaagaagggccagtga

DBGET integrated database retrieval system